Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant protein Human Periostin(POSTN) was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 90 kDa.)

Periostin (POSTN) Active Protein | POSTN active protein

Recombinant Human Periostin (POSTN) Protein

Gene Names
POSTN; PN; OSF2; OSF-2; PDLPOSTN
Purity
>95% by SDS-PAGE.
Synonyms
Periostin (POSTN); Recombinant Human Periostin (POSTN) Protein; OSF-2; OSF2; PDLPOSTN; PN; POSTN active protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20 mM Tris, 150 mM NaCl, pH8.0.
Sequence
NNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTN
Sequence Length
836
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to induce adhesion of ATDC5 mouse chondrogenic cells. Immobilized Recombinant Human Periostin/POSTN at 10 ug/mL (100 uL/well) induces >50% cell adhesion.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human Periostin(POSTN) was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 90 kDa.)

SDS-Page (Recombinant protein Human Periostin(POSTN) was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 90 kDa.)
Related Product Information for POSTN active protein
Description: Recombinant Human Periostin(POSTN) Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Asn22-Gln836) of human Periostin(POSTN) (Accession #Q15063) fused with a 6xHis tag at the C-terminus.

Background: This protein belongs a secreted extracellular matrix protein that functions in tissue development and regeneration, including wound healing, and ventricular remodeling following myocardial infarction. The encoded protein binds to integrins to support adhesion and migration of epithelial cells. This protein plays a role in cancer stem cell maintenance and metastasis. Mice lacking this gene exhibit cardiac valve disease, and skeletal and dental defects. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for POSTN active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
periostin isoform 1
NCBI Official Synonym Full Names
periostin
NCBI Official Symbol
POSTN
NCBI Official Synonym Symbols
PN; OSF2; OSF-2; PDLPOSTN
NCBI Protein Information
periostin
UniProt Protein Name
Periostin
Protein Family
UniProt Gene Name
POSTN
UniProt Synonym Gene Names
OSF2; PN; OSF-2
UniProt Entry Name
POSTN_HUMAN

NCBI Description

This gene encodes a secreted extracellular matrix protein that functions in tissue development and regeneration, including wound healing, and ventricular remodeling following myocardial infarction. The encoded protein binds to integrins to support adhesion and migration of epithelial cells. This protein plays a role in cancer stem cell maintenance and metastasis. Mice lacking this gene exhibit cardiac valve disease, and skeletal and dental defects. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]

Uniprot Description

POSTN: Binds to heparin. Induces cell attachment and spreading and plays a role in cell adhesion. May play a role in extracellular matrix mineralization. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted; Cell adhesion; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 13q13.3

Cellular Component: extracellular matrix; proteinaceous extracellular matrix; extracellular space; trans-Golgi network

Molecular Function: heparin binding; protein binding; cell adhesion molecule binding

Biological Process: tissue development; extracellular matrix organization and biogenesis; regulation of Notch signaling pathway; cell adhesion; skeletal development

Research Articles on POSTN

Similar Products

Product Notes

The POSTN postn (Catalog #AAA9139866) is an Active Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: NNHYDKILAH SRIRGRDQGP NVCALQQILG TKKKYFSTCK NWYKKSICGQ KTTVLYECCP GYMRMEGMKG CPAVLPIDHV YGTLGIVGAT TTQRYSDASK LREEIEGKGS FTYFAPSNEA WDNLDSDIRR GLESNVNVEL LNALHSHMIN KRMLTKDLKN GMIIPSMYNN LGLFINHYPN GVVTVNCARI IHGNQIATNG VVHVIDRVLT QIGTSIQDFI EAEDDLSSFR AAAITSDILE ALGRDGHFTL FAPTN. It is sometimes possible for the material contained within the vial of "Periostin (POSTN), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.