Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human HGF/Hepatocyte Growth Factor Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

HGF/Hepatocyte Growth Factor Active Protein | HGF active protein

Recombinant Human HGF/Hepatocyte Growth Factor Protein

Gene Names
HGF; SF; HGFB; HPTA; F-TCF; DFNB39
Purity
>95% by SDS-PAGE.
Synonyms
HGF/Hepatocyte Growth Factor; Recombinant Human HGF/Hepatocyte Growth Factor Protein; Hepatocyte growth factor; HPTA; HGF; SF; Scatter factor; Hepatopoietin-A; HGF active protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 uM filtered solution of 20mM Tris, 150mM NaCl, pH8.0
Sequence
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIK
Sequence Length
728
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to induce IL-11 secretion by Saos-2 human osteosarcoma cells. The ED50 for this effect is 0.1-0.5 ng/mL. The specific activity of recombinant human HGF is approximately 1.5 x 103 IU/ ug, which is calibrated against recombinant human HGF WHO International Standard.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human HGF/Hepatocyte Growth Factor Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human HGF/Hepatocyte Growth Factor Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for HGF active protein
Description: Recombinant Human HGF/Hepatocyte Growth Factor Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln32-Ser728) of human HGF/Hepatocyte Growth Factor (Accession #P14210) fused with a 6xHis tag at the C-terminus.

Background: Hepatocyte growth factor/scatter factor (HGF/SF) is a paracrine cellular growth, motility and morphogenicfactor. It belongs to the peptidase S1 family and Plasminogen subfamily, contains 4 kringle domains, 1 PANdomain and 1 peptidase S1 domain. HGF regulates cell growth, cell motility, and morphogenesis by activatinga tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. HGF is secreted bymesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability tostimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis,and tissue regeneration.
Product Categories/Family for HGF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Hepatocyte growth factor
NCBI Official Synonym Full Names
hepatocyte growth factor
NCBI Official Symbol
HGF
NCBI Official Synonym Symbols
SF; HGFB; HPTA; F-TCF; DFNB39
NCBI Protein Information
hepatocyte growth factor
UniProt Protein Name
Hepatocyte growth factor
Protein Family
UniProt Gene Name
HGF
UniProt Synonym Gene Names
HPTA; SF
UniProt Entry Name
HGF_HUMAN

NCBI Description

This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. [provided by RefSeq, Nov 2015]

Uniprot Description

HGF: HGF is a potent mitogen for mature parenchymal hepatocyte cells, seems to be an hepatotrophic factor, and acts as growth factor for a broad spectrum of tissues and cell types. It has no detectable protease activity. Activating ligand for the receptor tyrosine kinase MET by binding and promoting its dimerization. Defects in HGF are the cause of deafness autosomal recessive type 39 (DFNB39). A form of profound prelingual sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Belongs to the peptidase S1 family. Plasminogen subfamily. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Hormone; Cell development/differentiation

Chromosomal Location of Human Ortholog: 7q21.1

Cellular Component: extracellular space; membrane; extracellular region

Molecular Function: identical protein binding; protein binding; growth factor activity; protein heterodimerization activity; serine-type endopeptidase activity; chemoattractant activity

Biological Process: positive regulation of myelination; mitosis; platelet activation; organ regeneration; activation of MAPK activity; myoblast proliferation; hepatocyte growth factor receptor signaling pathway; negative regulation of caspase activity; proteolysis; liver development; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of osteoblast differentiation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of angiogenesis; platelet degranulation; positive chemotaxis; epithelial to mesenchymal transition; positive regulation of transcription from RNA polymerase II promoter; blood coagulation; hyaluronan metabolic process; positive regulation of cell migration

Disease: Deafness, Autosomal Recessive 39

Research Articles on HGF

Similar Products

Product Notes

The HGF hgf (Catalog #AAA9140081) is an Active Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QRKRRNTIHE FKKSAKTTLI KIDPALKIKT KKVNTADQCA NRCTRNKGLP FTCKAFVFDK ARKQCLWFPF NSMSSGVKKE FGHEFDLYEN KDYIRNCIIG KGRSYKGTVS ITKSGIKCQP WSSMIPHEHS FLPSSYRGKD LQENYCRNPR GEEGGPWCFT SNPEVRYEVC DIPQCSEVEC MTCNGESYRG LMDHTESGKI CQRWDHQTPH RHKFLPERYP DKGFDDNYCR NPDGQPRPWC YTLDPHTRWE YCAIK. It is sometimes possible for the material contained within the vial of "HGF/Hepatocyte Growth Factor, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.