Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

USP2 blocking peptide

USP2 Peptide - middle region

Gene Names
USP2; USP9; UBP41
Reactivity
Human
Synonyms
USP2; USP2 Peptide - middle region; USP2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVG
Sequence Length
396
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for USP2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- USP2 Antibody, made

Target Description: This gene encodes a member of the family of de-ubiquitinating enzymes, which belongs to the peptidase C19 superfamily. The encoded protein is a ubiquitin-specific protease which is required for TNF-alpha (tumor necrosis factor alpha) -induced NF-kB (nuclear factor kB) signaling. This protein deubiquitinates polyubiquitinated target proteins such as fatty acid synthase, murine double minute 2 (MDM2), MDM4/MDMX and cyclin D1. MDM2 and MDM4 are negative regulators of the p53 tumor suppressor and cyclin D1 is required for cell cycle G1/S transition. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for USP2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 2 isoform c
NCBI Official Synonym Full Names
ubiquitin specific peptidase 2
NCBI Official Symbol
USP2
NCBI Official Synonym Symbols
USP9; UBP41
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 2
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 2
Protein Family
UniProt Gene Name
USP2
UniProt Synonym Gene Names
UBP41
UniProt Entry Name
UBP2_HUMAN

NCBI Description

This gene encodes a member of the family of de-ubiquitinating enzymes, which belongs to the peptidase C19 superfamily. The encoded protein is a ubiquitin-specific protease which is required for TNF-alpha (tumor necrosis factor alpha) -induced NF-kB (nuclear factor kB) signaling. This protein deubiquitinates polyubiquitinated target proteins such as fatty acid synthase, murine double minute 2 (MDM2), MDM4/MDMX and cyclin D1. MDM2 and MDM4 are negative regulators of the p53 tumor suppressor and cyclin D1 is required for cell cycle G1/S transition. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]

Uniprot Description

USP2: Hydrolase that deubiquitinates polyubiquitinated target proteins such as MDM2, MDM4 and CCND1. Isoform 1 and isoform 4 possess both ubiquitin-specific peptidase and isopeptidase activities. Deubiquitinates MDM2 without reversing MDM2-mediated p53/TP53 ubiquitination and thus indirectly promotes p53/TP53 degradation and limits p53 activity. Has no deubiquitinase activity against p53/TP53. Prevents MDM2-mediated degradation of MDM4. Plays a role in the G1/S cell-cycle progression in normal and cancer cells. Plays a role in the regulation of myogenic differentiation of embryonic muscle cells. Homooligomer. Found in trimeric complex with MDM2 and MDM4 and UPB2. Interacts with CCND1; the interaction is direct and promotes its stabilization by antagonizing ubiquitin-dependent degradation. Interacts (via N-terminus and C- terminus) with MDM2. Interacts with MDM4. Down-regulated by cisplatin. Expressed in mesangial cells of the kidney and in different types of glomerulonephritides. Cleavage is inhibited by ubiquitin in a dosage- dependent manner. Cleavage is blocked by ubiquitin aldehyde. Belongs to the peptidase C19 family. USP2 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin-specific protease; Protease; EC 3.4.19.12

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: centrosome; perinuclear region of cytoplasm; cytoplasm; cell cortex; nucleus

Molecular Function: identical protein binding; protein binding; cyclin binding; ubiquitin protein ligase binding; metal ion binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; negative regulation of skeletal muscle development; muscle development; protein deubiquitination; protein stabilization; positive regulation of skeletal muscle development; negative regulation of transcription from RNA polymerase II promoter; positive regulation of mitotic cell cycle; cell cycle; circadian behavior; entrainment of circadian clock by photoperiod; locomotor rhythm; circadian regulation of gene expression

Research Articles on USP2

Similar Products

Product Notes

The USP2 usp2 (Catalog #AAA3247092) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The USP2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLHNEVNRVT LRPKSNPENL DHLPDDEKGR QMWRKYLERE DSRIGDLFVG. It is sometimes possible for the material contained within the vial of "USP2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.