TRMU blocking peptide
TRMU Peptide - N-terminal region
Gene Names
TRMU; MTO2; MTU1; TRMT; LCAL3; TRMT1
Reactivity
Human
Applications
Western Blot
Synonyms
TRMU; TRMU Peptide - N-terminal region; TRMU blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSC
Sequence Length
376
Applicable Applications for TRMU blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TRMU blocking peptide
This is a synthetic peptide designed for use in combination with anti-TRMU Antibody, made
Target Description: This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.
Target Description: This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.
Product Categories/Family for TRMU blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
mitochondrial tRNA-specific 2-thiouridylase 1 isoform e
NCBI Official Synonym Full Names
tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
NCBI Official Symbol
TRMU
NCBI Official Synonym Symbols
MTO2; MTU1; TRMT; LCAL3; TRMT1
NCBI Protein Information
mitochondrial tRNA-specific 2-thiouridylase 1
UniProt Protein Name
Mitochondrial tRNA-specific 2-thiouridylase 1
Protein Family
UniProt Gene Name
TRMU
UniProt Synonym Gene Names
MTU1; TRMT1
UniProt Entry Name
MTU1_HUMAN
NCBI Description
This nuclear gene encodes a mitochondrial tRNA-modifying enzyme. The encoded protein catalyzes the 2-thiolation of uridine on the wobble positions of tRNA(Lys), tRNA(Glu), and tRNA(Gln), resulting in the formation of 5-taurinomethyl-2-thiouridine moieties. Mutations in this gene may cause transient infantile liver failure. Polymorphisms in this gene may also influence the severity of deafness caused by mitochondrial 12S ribosomal RNA mutations. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
Research Articles on TRMU
Similar Products
Product Notes
The TRMU trmu (Catalog #AAA3234147) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRMU Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRMU can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRMU trmu for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VCQILDIPFH QVSYVKEYWN DVFSDFLNEY EKGRTPNPDI VCNKHIKFSC. It is sometimes possible for the material contained within the vial of "TRMU, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
