Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TRIP6 blocking peptide

TRIP6 Peptide - middle region

Gene Names
TRIP6; OIP1; OIP-1; ZRP-1; TRIP-6; TRIP6i2
Reactivity
Human
Synonyms
TRIP6; TRIP6 Peptide - middle region; TRIP6 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHF
Sequence Length
476
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TRIP6 blocking peptide
This is a synthetic peptide designed for use in combination with anti- TRIP6 Antibody, made

Target Description: This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Product Categories/Family for TRIP6 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
thyroid receptor-interacting protein 6
NCBI Official Synonym Full Names
thyroid hormone receptor interactor 6
NCBI Official Symbol
TRIP6
NCBI Official Synonym Symbols
OIP1; OIP-1; ZRP-1; TRIP-6; TRIP6i2
NCBI Protein Information
thyroid receptor-interacting protein 6
UniProt Protein Name
Thyroid receptor-interacting protein 6
UniProt Gene Name
TRIP6
UniProt Synonym Gene Names
OIP1; TR-interacting protein 6; TRIP-6; OIP-1; ZRP-1
UniProt Entry Name
TRIP6_HUMAN

NCBI Description

This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

TRIP6: thyroid receptor interacting protein 6 specifically interacts with the ligand-binding domain of the thyroid receptor (TR). Requires the presence of thyroid hormone for its interaction. Interacts with PTPN13. Functions downstream of the activated LPA(2) receptor and is involved in cell adhesion and migration.

Protein type: Nuclear receptor co-regulator; Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: interleukin-1 receptor complex; cytoskeleton; focal adhesion; cytoplasm; plasma membrane; nucleus

Molecular Function: protein binding; interleukin-1 receptor binding; zinc ion binding; thyroid hormone receptor binding; kinase binding

Biological Process: release of cytoplasmic sequestered NF-kappaB; focal adhesion formation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of cell migration

Research Articles on TRIP6

Similar Products

Product Notes

The TRIP6 trip6 (Catalog #AAA3247224) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRIP6 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GPTPASYTTA STPAGPAFPV QVKVAQPVRG CGPPRRGASQ ASGPLPGPHF. It is sometimes possible for the material contained within the vial of "TRIP6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.