Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TRIP4 blocking peptide

TRIP4 Peptide - middle region

Reactivity
Human
Synonyms
TRIP4; TRIP4 Peptide - middle region; TRIP4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLAKA
Sequence Length
581
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TRIP4 blocking peptide
This is a synthetic peptide designed for use in combination with anti- TRIP4 Antibody, made

Target Description: This gene encodes a subunit of the tetrameric nuclear activating signal cointegrator 1 (ASC-1) complex, which associates with transcriptional coactivators, nuclear receptors and basal transcription factors to facilitate nuclear receptors-mediated transcription. This protein is localized in the nucleus and contains an E1A-type zinc finger domain, which mediates interaction with transcriptional coactivators and ligand-bound nuclear receptors, such as thyroid hormone receptor and retinoid X receptor alpha, but not glucocorticoid receptor. Mutations in this gene are associated with spinal muscular atrophy with congenital bone fractures-1 (SMABF1). 
Product Categories/Family for TRIP4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
UniProt Protein Name
Activating signal cointegrator 1
UniProt Gene Name
TRIP4
UniProt Synonym Gene Names
ASC-1; TR-interacting protein 4; TRIP-4
UniProt Entry Name
TRIP4_HUMAN

Uniprot Description

TRIP4: thyroid receptor interacting protein 4 is a transcription coactivator of nuclear receptors including thyroid hormone receptor. Functions in conjunction with CBP-p300 and SRC-1. Plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. Acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B. Plays a role in androgen receptor transactivation and in testicular function

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 15q22.31

Cellular Component: nucleoplasm; cytoplasm; microtubule organizing center; nucleus; cytosol

Molecular Function: ligand-dependent nuclear receptor binding; histone acetyltransferase binding; protein binding; protease binding; zinc ion binding; transcription coactivator activity; estrogen receptor binding

Biological Process: transcription from RNA polymerase II promoter; estrogen receptor signaling pathway; positive regulation of transcription, DNA-dependent

Similar Products

Product Notes

The TRIP4 trip4 (Catalog #AAA3247426) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRIP4 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: FKKDEILDGQ KSGDHLKRGR KKGRNRQEVP AFTEPDTTAE VKTPFDLAKA. It is sometimes possible for the material contained within the vial of "TRIP4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.