Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TRIP4Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TRIP4 Polyclonal Antibody | anti-TRIP4 antibody

TRIP4 Antibody - middle region

Gene Names
TRIP4; ASC1; ASC-1; MDCDC; SMABF1; ZC2HC5; HsT17391
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TRIP4; Polyclonal Antibody; TRIP4 Antibody - middle region; anti-TRIP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLA
Sequence Length
581
Applicable Applications for anti-TRIP4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human TRIP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TRIP4Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRIP4Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TRIP4 antibody
Transcription coactivator which associates with nuclear receptors, transcriptional coactivators including EP300, CREBBP and NCOA1, and basal transcription factors like TBP and TFIIA to facilitate nuclear receptors-mediated transcription. May thereby play an important role in establishing distinct coactivator complexes under different cellular conditions. Plays a role in thyroid hormone receptor and estrogen receptor transactivation. Also involved in androgen receptor transactivation (By similarity). Plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. Acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B. May play a role in the development of neuromuscular junction. May play a role in late myogenic differentiation (By similarity).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
NCBI Official Full Name
activating signal cointegrator 1 isoform 1
NCBI Official Synonym Full Names
thyroid hormone receptor interactor 4
NCBI Official Symbol
TRIP4
NCBI Official Synonym Symbols
ASC1; ASC-1; MDCDC; SMABF1; ZC2HC5; HsT17391
NCBI Protein Information
activating signal cointegrator 1
UniProt Protein Name
Activating signal cointegrator 1
UniProt Gene Name
TRIP4
UniProt Synonym Gene Names
ASC-1; TR-interacting protein 4; TRIP-4
UniProt Entry Name
TRIP4_HUMAN

NCBI Description

This gene encodes a subunit of the tetrameric nuclear activating signal cointegrator 1 (ASC-1) complex, which associates with transcriptional coactivators, nuclear receptors and basal transcription factors to facilitate nuclear receptors-mediated transcription. This protein is localized in the nucleus and contains an E1A-type zinc finger domain, which mediates interaction with transcriptional coactivators and ligand-bound nuclear receptors, such as thyroid hormone receptor and retinoid X receptor alpha, but not glucocorticoid receptor. Mutations in this gene are associated with spinal muscular atrophy with congenital bone fractures-1 (SMABF1). [provided by RefSeq, Apr 2016]

Uniprot Description

TRIP4: thyroid receptor interacting protein 4 is a transcription coactivator of nuclear receptors including thyroid hormone receptor. Functions in conjunction with CBP-p300 and SRC-1. Plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. Acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B. Plays a role in androgen receptor transactivation and in testicular function

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 15q22.31

Cellular Component: nucleoplasm; cytoplasm; microtubule organizing center; nucleus; cytosol

Molecular Function: ligand-dependent nuclear receptor binding; histone acetyltransferase binding; protein binding; protease binding; zinc ion binding; transcription coactivator activity; estrogen receptor binding

Biological Process: transcription from RNA polymerase II promoter; estrogen receptor signaling pathway; positive regulation of transcription, DNA-dependent

Research Articles on TRIP4

Similar Products

Product Notes

The TRIP4 trip4 (Catalog #AAA3222048) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIP4 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIP4 trip4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QCFKKDEILD GQKSGDHLKR GRKKGRNRQE VPAFTEPDTT AEVKTPFDLA. It is sometimes possible for the material contained within the vial of "TRIP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.