Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TRADD blocking peptide

TRADD Peptide - N-terminal region

Gene Names
TRADD; Hs.89862
Reactivity
Human
Synonyms
TRADD; TRADD Peptide - N-terminal region; TRADD blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAE
Sequence Length
312
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TRADD blocking peptide
This is a synthetic peptide designed for use in combination with anti- TRADD Antibody, made

Target Description: The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway.
Product Categories/Family for TRADD blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
tumor necrosis factor receptor type 1-associated DEATH domain protein
NCBI Official Synonym Full Names
TNFRSF1A associated via death domain
NCBI Official Symbol
TRADD
NCBI Official Synonym Symbols
Hs.89862
NCBI Protein Information
tumor necrosis factor receptor type 1-associated DEATH domain protein
UniProt Protein Name
Tumor necrosis factor receptor type 1-associated DEATH domain protein
UniProt Gene Name
TRADD
UniProt Synonym Gene Names
TNFR1-associated DEATH domain protein
UniProt Entry Name
TRADD_HUMAN

NCBI Description

The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

TRADD: Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B. Heterodimer with TNFRSF1A/TNFR1. Interacts with DAB2IP, FADD, HIPK2, KRT14, KRT16, KRT17, KRT18, RIPK1, SQSTM1, TRAF1, TRAF2 and TRPC4AP. Found in all examined tissues.

Protein type: Adaptor/scaffold; Apoptosis

Chromosomal Location of Human Ortholog: 16q22

Cellular Component: cytoskeleton; cytoplasm; nucleus; cytosol; receptor complex; lipid raft

Molecular Function: identical protein binding; signal transducer activity; protein binding; protein complex binding; tumor necrosis factor receptor binding; kinase binding; molecular adaptor activity

Biological Process: caspase activation; positive regulation of hair follicle development; positive regulation of I-kappaB kinase/NF-kappaB cascade; induction of apoptosis via death domain receptors; tumor necrosis factor-mediated signaling pathway; protein heterooligomerization; apoptosis; positive regulation of apoptosis; signal transduction; activation of NF-kappaB transcription factor

Research Articles on TRADD

Similar Products

Product Notes

The TRADD tradd (Catalog #AAA3247746) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRADD Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAGQNGHEEW VGSAYLFVES SLDKVVLSDA YAHPQQKVAV YRALQAALAE. It is sometimes possible for the material contained within the vial of "TRADD, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.