Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TFRC blocking peptide

TFRC Peptide - N-terminal region

Gene Names
TFRC; T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Synonyms
TFRC; TFRC Peptide - N-terminal region; TFRC blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
GYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSE
Sequence Length
760
Applicable Applications for TFRC blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TFRC blocking peptide
This is a synthetic peptide designed for use in combination with anti-TFRC Antibody, made

Target Description: TFRC is a cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system By similarity. A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site.
Product Categories/Family for TFRC blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
transferrin receptor protein 1 isoform 1
NCBI Official Synonym Full Names
transferrin receptor
NCBI Official Symbol
TFRC
NCBI Official Synonym Symbols
T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
NCBI Protein Information
transferrin receptor protein 1
UniProt Protein Name
Transferrin receptor protein 1
UniProt Gene Name
TFRC
UniProt Synonym Gene Names
TR; TfR; TfR1; Trfr; sTfR
UniProt Entry Name
TFR1_HUMAN

NCBI Description

This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]

Uniprot Description

TfR: the transferrin receptor. Regulates the cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied receptors into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system.

Protein type: Membrane protein, integral; Receptor, misc.; Cell surface

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: extracellular space; cell surface; intracellular membrane-bound organelle; integral to plasma membrane; cytoplasmic membrane-bound vesicle; extracellular region; coated pit; recycling endosome; membrane; perinuclear region of cytoplasm; melanosome; plasma membrane; vesicle; endosome; external side of plasma membrane

Molecular Function: identical protein binding; protein binding; transferrin receptor activity; double-stranded RNA binding

Biological Process: receptor-mediated endocytosis; viral reproduction; cellular iron ion homeostasis; positive regulation of bone resorption; transferrin transport; osteoclast differentiation; regulation of cell growth; transmembrane transport; regulation of cell proliferation

Research Articles on TFRC

Similar Products

Product Notes

The TFRC tfrc (Catalog #AAA3241044) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TFRC Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TFRC can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TFRC tfrc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GYLGYCKGVE PKTECERLAG TESPVREEPG EDFPAARRLY WDDLKRKLSE. It is sometimes possible for the material contained within the vial of "TFRC, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.