Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

SZRD1 blocking peptide

SZRD1 Peptide - middle region

Gene Names
SZRD1; C1orf144
Reactivity
Human
Applications
Western Blot
Synonyms
SZRD1; SZRD1 Peptide - middle region; SZRD1 blocking peptide
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFK
Sequence Length
167
Applicable Applications for SZRD1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Product Categories/Family for SZRD1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
SUZ domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
SUZ RNA binding domain containing 1
NCBI Official Symbol
SZRD1
NCBI Official Synonym Symbols
C1orf144
NCBI Protein Information
SUZ domain-containing protein 1
UniProt Protein Name
SUZ domain-containing protein 1
UniProt Gene Name
SZRD1
UniProt Synonym Gene Names
C1orf144
UniProt Entry Name
SZRD1_HUMAN

Uniprot Description

SZRD1: Belongs to the SZRD1 family. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1p36.13

Similar Products

Product Notes

The SZRD1 szrd1 (Catalog #AAA3245416) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SZRD1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SZRD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SZRD1 szrd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KRILGSASPE EEQEKPILDR PTRISQPEDS RQPNNVIRQP LGPDGSQGFK. It is sometimes possible for the material contained within the vial of "SZRD1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual