SYT14 blocking peptide

SYT14 Peptide - middle region

Cat. Num. AAA3242525

• Gene Names: SYT14; SCAR11; sytXIV
• Reactivity: Human
• Applications: Western Blot
• Synonyms: SYT14; SYT14 Peptide - middle region; SYT14 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: HCSNSPRCSYNKCPSEGSTGHEIESFHNKGYEEDVPSDSTAVLSPEDMSA
• Sequence Length: 555

• Applicable Applications for SYT14 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for SYT14 blocking peptide

This is a synthetic peptide designed for use in combination with anti-SYT14 Antibody, made

Target Description: This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that mediate membrane trafficking in synaptic transmission. The encoded protein is a calcium-independent synaptotagmin. Mutations in this gene are a cause of autosomal recessive spinocerebellar ataxia-11 (SCAR11), and a t(1;3) translocation of this gene has been associated with neurodevelopmental abnormalities. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4.

Product Categories/Family for SYT14 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 144226225
• NCBI GeneID: 255928
• NCBI Accession #: NP_694994
• NCBI GenBank Nucleotide #: NM_153262
• UniProt Accession #: Q8NB59
• Molecular Weight: 62kDa
• NCBI Official Full Name: synaptotagmin-14 isoform 4
• NCBI Official Synonym Full Names: synaptotagmin 14
• NCBI Official Symbol: SYT14
• NCBI Official Synonym Symbols: SCAR11; sytXIV
• NCBI Protein Information: synaptotagmin-14
• UniProt Protein Name: Synaptotagmin-14
• Protein Family: Synaptotagmin
• UniProt Gene Name: SYT14
• UniProt Synonym Gene Names: SytXIV

NCBI Description

This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that mediate membrane trafficking in synaptic transmission. The encoded protein is a calcium-independent synaptotagmin. Mutations in this gene are a cause of autosomal recessive spinocerebellar ataxia-11 (SCAR11), and a t(1;3) translocation of this gene has been associated with neurodevelopmental abnormalities. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4. [provided by RefSeq, Dec 2011]

Uniprot Description

May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues. Is Ca2+-independent.