Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SYNCRIP blocking peptide

SYNCRIP Peptide - C-terminal region

Gene Names
SYNCRIP; PP68; NSAP1; GRYRBP; HNRNPQ; HNRPQ1; GRY-RBP; hnRNP-Q
Reactivity
Human
Applications
Western Blot
Synonyms
SYNCRIP; SYNCRIP Peptide - C-terminal region; SYNCRIP blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTF
Sequence Length
623
Applicable Applications for SYNCRIP blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SYNCRIP blocking peptide
This is a synthetic peptide designed for use in combination with anti-SYNCRIP Antibody, made
Product Categories/Family for SYNCRIP blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70 kDa
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein Q isoform 2
NCBI Official Synonym Full Names
synaptotagmin binding cytoplasmic RNA interacting protein
NCBI Official Symbol
SYNCRIP
NCBI Official Synonym Symbols
PP68; NSAP1; GRYRBP; HNRNPQ; HNRPQ1; GRY-RBP; hnRNP-Q
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein Q
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein Q
UniProt Gene Name
SYNCRIP
UniProt Synonym Gene Names
HNRPQ; NSAP1; hnRNP Q; GRY-RBP
UniProt Entry Name
HNRPQ_HUMAN

NCBI Description

This gene encodes a member of the cellular heterogeneous nuclear ribonucleoprotein (hnRNP) family. hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA) and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. The encoded protein plays a role in multiple aspects of mRNA maturation and is associated with several multiprotein complexes including the apoB RNA editing-complex and survival of motor neurons (SMN) complex. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 20. [provided by RefSeq, Dec 2011]

Uniprot Description

NSAP1: a heterogeneous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. A component of the spliceosome. Five alternatively spliced isoforms have been described. Isoform 1, 2 and 3 are associated with pre-mRNA, splicing intermediates and mature mRNA protein complexes. Isoform 1 binds to apoB mRNA AU-rich sequences. Isoform 1 is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to ACF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. Isoform 3 may be involved in cytoplasmic vesicle-based mRNA transport through interaction with synaptotagmins.

Protein type: RNA-binding; Motility/polarity/chemotaxis; RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 6q14-q15

Cellular Component: nucleoplasm; membrane; endoplasmic reticulum; nucleus; ribonucleoprotein complex

Molecular Function: protein binding; RNA binding; nucleotide binding; poly(A) binding

Biological Process: nuclear mRNA splicing, via spliceosome; osteoblast differentiation; RNA processing; viral reproduction; negative regulation of translation; RNA splicing

Research Articles on SYNCRIP

Similar Products

Product Notes

The SYNCRIP syncrip (Catalog #AAA3244705) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SYNCRIP Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SYNCRIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYNCRIP syncrip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYNQPDSKRR QTNNQNWGSQ PIAQQPLQGG DHSGNYGYKS ENQEFYQDTF. It is sometimes possible for the material contained within the vial of "SYNCRIP, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.