Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SYF2 blocking peptide

SYF2 Peptide - C-terminal region

Gene Names
SYF2; P29; CBPIN; NTC31; fSAP29
Reactivity
Human
Synonyms
SYF2; SYF2 Peptide - C-terminal region; SYF2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: EEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDAD
Sequence Length
243
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SYF2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SYF2 Antibody, made

Target Description: This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for SYF2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
pre-mRNA-splicing factor SYF2 isoform 1
NCBI Official Synonym Full Names
SYF2 pre-mRNA splicing factor
NCBI Official Symbol
SYF2
NCBI Official Synonym Symbols
P29; CBPIN; NTC31; fSAP29
NCBI Protein Information
pre-mRNA-splicing factor SYF2
UniProt Protein Name
Pre-mRNA-splicing factor SYF2
Protein Family
UniProt Gene Name
SYF2
UniProt Synonym Gene Names
CBPIN; GCIPIP
UniProt Entry Name
SYF2_HUMAN

NCBI Description

This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

SYF2: May be involved in pre-mRNA splicing. Belongs to the SYF2 family.

Protein type: RNA-binding; RNA processing; RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: nucleus

Biological Process: nuclear mRNA splicing, via spliceosome; in utero embryonic development; mitotic cell cycle G2/M transition DNA damage checkpoint; embryonic organ development; gastrulation

Research Articles on SYF2

Similar Products

Product Notes

The SYF2 syf2 (Catalog #AAA3244875) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SYF2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEFFPTSNSL LHGTHVPSTE EIDRMVIDLE KQIEKRDKYS RRRPYNDDAD. It is sometimes possible for the material contained within the vial of "SYF2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.