Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SPAG6 blocking peptide

SPAG6 Peptide - middle region

Gene Names
SPAG6; pf16; CT141; Repro-SA-1
Reactivity
Human
Applications
Western Blot
Synonyms
SPAG6; SPAG6 Peptide - middle region; SPAG6 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQLST
Sequence Length
458
Applicable Applications for SPAG6 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SPAG6 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SPAG6 Antibody, made

Target Description: SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.
Product Categories/Family for SPAG6 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
sperm-associated antigen 6 isoform 2
NCBI Official Synonym Full Names
sperm associated antigen 6
NCBI Official Symbol
SPAG6
NCBI Official Synonym Symbols
pf16; CT141; Repro-SA-1
NCBI Protein Information
sperm-associated antigen 6
UniProt Protein Name
Sperm-associated antigen 6
Protein Family
UniProt Gene Name
SPAG6
UniProt Synonym Gene Names
PF16
UniProt Entry Name
SPAG6_HUMAN

NCBI Description

The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Research Articles on SPAG6

Similar Products

Product Notes

The SPAG6 spag6 (Catalog #AAA3236498) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SPAG6 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPAG6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPAG6 spag6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LQKCTYLPAL EPFLYDAPPN ILKHVVGQFS KVLFPWIFRY TSAEGGQLST. It is sometimes possible for the material contained within the vial of "SPAG6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.