Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SORBS1 blocking peptide

SORBS1 Peptide - middle region

Gene Names
SORBS1; CAP; FLAF2; R85FL; SH3D5; SORB1; SH3P12
Reactivity
Human
Synonyms
SORBS1; SORBS1 Peptide - middle region; SORBS1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SERRVGEQDSAPTQEKPTSPGKAIEKRAKDDSRRVVKSTQDLSDVSMDEV
Sequence Length
628
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SORBS1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- SORBS1 Antibody, made

Target Description: This gene encodes a CBL-associated protein which functions in the signaling and stimulation of insulin. Mutations in this gene may be associated with human disorders of insulin resistance. Alternative splicing results in multiple transcript variants.
Product Categories/Family for SORBS1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69 kDa
NCBI Official Synonym Full Names
sorbin and SH3 domain containing 1
NCBI Official Symbol
SORBS1
NCBI Official Synonym Symbols
CAP; FLAF2; R85FL; SH3D5; SORB1; SH3P12
NCBI Protein Information
sorbin and SH3 domain-containing protein 1
UniProt Protein Name
Sorbin and SH3 domain-containing protein 1
UniProt Gene Name
SORBS1
UniProt Synonym Gene Names
CAP
UniProt Entry Name
SRBS1_HUMAN

NCBI Description

This gene encodes a CBL-associated protein which functions in the signaling and stimulation of insulin. Mutations in this gene may be associated with human disorders of insulin resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]

Uniprot Description

SORBS1: Plays a role in tyrosine phosphorylation of CBL by linking CBL to the insulin receptor. Required for insulin- stimulated glucose transport. Involved in formation of actin stress fibers and focal adhesions. 12 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis; Cell adhesion

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: centrosome; nuclear matrix; focal adhesion; zonula adherens; cytosol; cell-substrate adherens junction; lipid raft; nucleoplasm; cell-cell adherens junction; cytoplasm; plasma membrane; stress fiber; nucleus

Molecular Function: protein binding; SH3/SH2 adaptor activity; cytoskeletal protein binding; actin binding; protein kinase binding; insulin receptor binding

Biological Process: focal adhesion formation; positive regulation of glucose import; cellular response to insulin stimulus; muscle contraction; positive regulation of signal transduction; cell-matrix adhesion; positive regulation of glycogen biosynthetic process; stress fiber formation; insulin receptor signaling pathway; positive regulation of lipid biosynthetic process; glucose transport

Research Articles on SORBS1

Similar Products

Product Notes

The SORBS1 sorbs1 (Catalog #AAA3241534) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SORBS1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SERRVGEQDS APTQEKPTSP GKAIEKRAKD DSRRVVKSTQ DLSDVSMDEV. It is sometimes possible for the material contained within the vial of "SORBS1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.