Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SNAP29 blocking peptide

SNAP29 Peptide - middle region

Gene Names
SNAP29; CEDNIK; SNAP-29
Reactivity
Human
Applications
Western Blot
Synonyms
SNAP29; SNAP29 Peptide - middle region; SNAP29 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP
Sequence Length
258
Applicable Applications for SNAP29 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SNAP29 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SNAP29 Antibody, made

Target Description: This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene.
Product Categories/Family for SNAP29 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
synaptosomal-associated protein 29
NCBI Official Synonym Full Names
synaptosome associated protein 29
NCBI Official Symbol
SNAP29
NCBI Official Synonym Symbols
CEDNIK; SNAP-29
NCBI Protein Information
synaptosomal-associated protein 29
UniProt Protein Name
Synaptosomal-associated protein 29
Protein Family
UniProt Gene Name
SNAP29
UniProt Synonym Gene Names
SNAP-29
UniProt Entry Name
SNP29_HUMAN

NCBI Description

This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SNAP29: Involved in multiple membrane trafficking steps. Defects in SNAP29 are the cause of CEDNIK syndrome (CEDNIK). CEDNIK is a neurocutaneous syndrome characterized by cerebral dysgenesis, neuropathy, ichthyosis and palmoplantar keratoderma. Belongs to the SNAP-25 family.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: SNARE complex; centrosome; neuron projection; cytoplasm; plasma membrane; synapse; cell junction

Molecular Function: SNAP receptor activity; syntaxin binding

Biological Process: synaptic vesicle fusion to presynaptic membrane; protein transport; exocytosis; autophagic vacuole fusion; vesicle targeting; synaptic vesicle priming

Disease: Cerebral Dysgenesis, Neuropathy, Ichthyosis, And Palmoplantar Keratoderma Syndrome

Research Articles on SNAP29

Similar Products

Product Notes

The SNAP29 snap29 (Catalog #AAA3239317) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SNAP29 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNAP29 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNAP29 snap29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QPNNRLKEAI STSKEQEAKY QASHPNLRKL DDTDPVPRGA GSAMSTDAYP. It is sometimes possible for the material contained within the vial of "SNAP29, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.