Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SMG9 blocking peptide

SMG9 Peptide - N-terminal region

Gene Names
SMG9; HBMS; C19orf61; F17127_1
Reactivity
Human
Synonyms
SMG9; SMG9 Peptide - N-terminal region; SMG9 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ESGHSQPGLYGIERRRRWKEPGSGGPQNLSGPGGRERDYIAPWERERRDA
Sequence Length
520
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SMG9 blocking peptide
This is a synthetic peptide designed for use in combination with anti- SMG9 Antibody, made

Target Description: Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited by release factors to stalled ribosomes together with SMG1 and SMG8 (forming the SMG1C protein kinase complex) and, in the SMG1C complex, is required for the efficient association between SMG1 and SMG8. Plays a role in brain, heart, and eye development.
Product Categories/Family for SMG9 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
protein SMG9
NCBI Official Synonym Full Names
SMG9 nonsense mediated mRNA decay factor
NCBI Official Symbol
SMG9
NCBI Official Synonym Symbols
HBMS; C19orf61; F17127_1
NCBI Protein Information
protein SMG9
UniProt Protein Name
Protein SMG9
Protein Family
UniProt Gene Name
SMG9
UniProt Synonym Gene Names
C19orf61
UniProt Entry Name
SMG9_HUMAN

NCBI Description

This gene encodes a regulatory subunit of the SMG1 complex, which plays a critical role in nonsense-mediated mRNA decay (NMD). Binding of the encoded protein to the SMG1 complex kinase scaffold protein results in the inhibition of its kinase activity. Mutations in this gene cause a multiple congenital anomaly syndrome in human patients, characterized by brain malformation, congenital heart disease and other features. [provided by RefSeq, Jul 2016]

Uniprot Description

SMG9: a conserved protein of unknown function.

Protein type: RNA processing

Chromosomal Location of Human Ortholog: 19q13.31

Cellular Component: intracellular; cytosol

Molecular Function: identical protein binding; protein binding

Biological Process: mRNA catabolic process, nonsense-mediated decay; gene expression

Research Articles on SMG9

Similar Products

Product Notes

The SMG9 smg9 (Catalog #AAA3246900) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SMG9 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESGHSQPGLY GIERRRRWKE PGSGGPQNLS GPGGRERDYI APWERERRDA. It is sometimes possible for the material contained within the vial of "SMG9, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.