Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SLC35D1 blocking peptide

SLC35D1 Peptide - C-terminal region

Gene Names
SLC35D1; SHNKND; UGTREL7
Reactivity
Human
Applications
Western Blot
Synonyms
SLC35D1; SLC35D1 Peptide - C-terminal region; SLC35D1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEANNKLDIKGKG
Sequence Length
355
Applicable Applications for SLC35D1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC35D1 blocking peptide
Glycosylation of cellular glycoconjugates occurs in the endoplasmic reticulum (ER) and Golgi compartment, and requires transport of nucleotide sugars from the cytosol into the lumen of the ER and Golgi by specific transporters. The protein encoded by this gene resides in the ER, and transports both UDP-glucuronic acid (UDP-GlcA) and UDP-N-acetylgalactosamine (UDP-GalNAc) from the cytoplasm to the ER lumen. It may participate in glucuronidation and/or chondroitin sulfate biosynthesis. Mutations in this gene are associated with Schneckenbecken dysplasia.
Product Categories/Family for SLC35D1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter
NCBI Official Synonym Full Names
solute carrier family 35 member D1
NCBI Official Symbol
SLC35D1
NCBI Official Synonym Symbols
SHNKND; UGTREL7
NCBI Protein Information
UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter
UniProt Protein Name
UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter
UniProt Gene Name
SLC35D1
UniProt Synonym Gene Names
KIAA0260; UGTREL7; UDP-GlcA/UDP-GalNAc transporter; UGTrel7
UniProt Entry Name
S35D1_HUMAN

NCBI Description

Glycosylation of cellular glycoconjugates occurs in the endoplasmic reticulum (ER) and Golgi compartment, and requires transport of nucleotide sugars from the cytosol into the lumen of the ER and Golgi by specific transporters. The protein encoded by this gene resides in the ER, and transports both UDP-glucuronic acid (UDP-GlcA) and UDP-N-acetylgalactosamine (UDP-GalNAc) from the cytoplasm to the ER lumen. It may participate in glucuronidation and/or chondroitin sulfate biosynthesis. Mutations in this gene are associated with Schneckenbecken dysplasia.[provided by RefSeq, Sep 2009]

Uniprot Description

SLC35D1: Transports both UDP-glucuronic acid (UDP-GlcA) and UDP- N-acetylgalactosamine (UDP-GalNAc) from the cytoplasm to into the endoplasmic reticulum lumen. May participate in glucuronidation and/or chondroitin sulfate biosynthesis. Defects in SLC35D1 are a cause of Schneckenbecken dysplasia (SCHBCKD). Schneckenbecken dysplagia is a rare, autosomal recessive, lethal short-limbed skeletal dysplasia with platyspondylia. Belongs to the TPT transporter family. SLC35D subfamily.

Protein type: Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, SLC family

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: UDP-glucuronic acid transmembrane transporter activity

Biological Process: chondroitin sulfate biosynthetic process; UDP-glucuronic acid transport; embryonic skeletal development; xenobiotic metabolic process; carbohydrate transport; UDP-glucuronate biosynthetic process; transmembrane transport

Disease: Schneckenbecken Dysplasia

Research Articles on SLC35D1

Similar Products

Product Notes

The SLC35D1 slc35d1 (Catalog #AAA3244467) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC35D1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC35D1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC35D1 slc35d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGDYIFTWTN FIGLNISIAG SLVYSYITFT EEQLSKQSEA NNKLDIKGKG. It is sometimes possible for the material contained within the vial of "SLC35D1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.