SLC35B2 blocking peptide
SLC35B2 Peptide - N-terminal region
Gene Names
SLC35B2; SLL; PAPST1; UGTrel4
Reactivity
Human
Applications
Western Blot
Synonyms
SLC35B2; SLC35B2 Peptide - N-terminal region; SLC35B2 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
Sequence Length
383
Applicable Applications for SLC35B2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC35B2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SLC35B2 Antibody, made
Target Description: Sulfotransferases use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen。
Target Description: Sulfotransferases use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen。
Product Categories/Family for SLC35B2 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
Adenosine 3'-phospho 5'-phosphosulfate transporter 1
NCBI Official Synonym Full Names
solute carrier family 35 member B2
NCBI Official Symbol
SLC35B2
NCBI Official Synonym Symbols
SLL; PAPST1; UGTrel4
NCBI Protein Information
adenosine 3'-phospho 5'-phosphosulfate transporter 1
UniProt Protein Name
Adenosine 3'-phospho 5'-phosphosulfate transporter 1
UniProt Gene Name
SLC35B2
UniProt Synonym Gene Names
PAPST1
UniProt Entry Name
S35B2_HUMAN
NCBI Description
Sulfotransferases (e.g., SULT4A1; MIM 608359) use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen (Kamiyama et al., 2003 [PubMed 12716889]).[supplied by OMIM, Mar 2008]
Research Articles on SLC35B2
Similar Products
Product Notes
The SLC35B2 slc35b2 (Catalog #AAA3242099) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC35B2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC35B2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC35B2 slc35b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLVQYFRRKN YLETGRGLCF PLVKACVFGN EPKASDEVPL APRTEAAETT. It is sometimes possible for the material contained within the vial of "SLC35B2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
