Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SLC2A3 blocking peptide

SLC2A3 Peptide - middle region

Gene Names
SLC2A3; GLUT3
Reactivity
Human
Applications
Western Blot
Synonyms
SLC2A3; SLC2A3 Peptide - middle region; SLC2A3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAG
Sequence Length
167
Applicable Applications for SLC2A3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Product Categories/Family for SLC2A3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
solute carrier family 2, facilitated glucose transporter member 3
NCBI Official Synonym Full Names
solute carrier family 2 member 3
NCBI Official Symbol
SLC2A3
NCBI Official Synonym Symbols
GLUT3
NCBI Protein Information
solute carrier family 2, facilitated glucose transporter member 3
UniProt Protein Name
Solute carrier family 2, facilitated glucose transporter member 3
Protein Family
UniProt Gene Name
SLC2A3
UniProt Synonym Gene Names
GLUT3; GLUT-3
UniProt Entry Name
GTR3_HUMAN

Uniprot Description

GLUT3: an integral membrane facilitative glucose transporter. One of 13 members of the human equilibrative glucose transport protein family. It???s surface expression is induced by insulin. It is restricted in humans to brain, testis (in the spermatozoa), and skeletal muscle, mostly in triads of slow-twitch fibres. Detected only in the brain of mouse and rat. IHC demonstrates its present in neurons, mainly at the plasma membrane, and to a lesser extent on intracellular vesicles distinct from synaptic vesicles. Present in the a-granules of human platelets, where it is translocated to the cell surface in response to thrombin stimulation. Its surface expression is increased by insulin or insulin growth-factor in cultured L6 muscle cells.

Protein type: Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, SLC family

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: integral to membrane; plasma membrane

Molecular Function: glucose transmembrane transporter activity

Biological Process: vitamin metabolic process; hexose transport; carbohydrate metabolic process; L-ascorbic acid metabolic process; pathogenesis; glucose transport; transmembrane transport; water-soluble vitamin metabolic process

Research Articles on SLC2A3

Similar Products

Product Notes

The SLC2A3 slc2a3 (Catalog #AAA3245215) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC2A3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC2A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC2A3 slc2a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSSYRQPIII SIVLQLSQQL SGINAVFYYS TGIFKDAGVQ EPIYATIGAG. It is sometimes possible for the material contained within the vial of "SLC2A3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.