Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SLC25A3 blocking peptide

SLC25A3 Peptide - N-terminal region

Gene Names
SLC25A3; PHC; PTP; OK/SW-cl.48
Reactivity
Human
Applications
Western Blot
Synonyms
SLC25A3; SLC25A3 Peptide - N-terminal region; SLC25A3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGS
Sequence Length
167
Applicable Applications for SLC25A3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC25A3 blocking peptide
The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated.
Product Categories/Family for SLC25A3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
phosphate carrier protein, mitochondrial isoform b
NCBI Official Synonym Full Names
solute carrier family 25 member 3
NCBI Official Symbol
SLC25A3
NCBI Official Synonym Symbols
PHC; PTP; OK/SW-cl.48
NCBI Protein Information
phosphate carrier protein, mitochondrial
UniProt Protein Name
Phosphate carrier protein, mitochondrial
UniProt Gene Name
SLC25A3
UniProt Synonym Gene Names
PHC; PTP
UniProt Entry Name
MPCP_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC25A3: Transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+). Defects in SLC25A3 are a cause of mitochondrial phosphate carrier deficiency (MPCD). MPCD is a fatal disorder of oxidative phosphorylation. Patients have lactic acidosis, hypertrophic cardiomyopathy and muscular hypotonia and die within the first year of life. Belongs to the mitochondrial carrier family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter, SLC family; Membrane protein, multi-pass; Mitochondrial; Transporter

Chromosomal Location of Human Ortholog: 12q23

Cellular Component: membrane; mitochondrion; integral to plasma membrane; mitochondrial inner membrane

Molecular Function: phosphate carrier activity; symporter activity; protein complex binding

Biological Process: generation of precursor metabolites and energy; transport

Disease: Mitochondrial Phosphate Carrier Deficiency

Research Articles on SLC25A3

Similar Products

Product Notes

The SLC25A3 slc25a3 (Catalog #AAA3245160) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC25A3 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC25A3 slc25a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NPFNTPHLQL VHDGLGDLRS SSPGPTGQPR RPRNLAAAAV EEQYSCDYGS. It is sometimes possible for the material contained within the vial of "SLC25A3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.