Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SLC16A7 blocking peptide

SLC16A7 Peptide - middle region

Gene Names
SLC16A7; MCT2
Reactivity
Human
Synonyms
SLC16A7; SLC16A7 Peptide - middle region; SLC16A7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGS
Sequence Length
478
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC16A7 blocking peptide
This is a synthetic peptide designed for use in combination with anti- SLC16A7 Antibody, made

Target Description: This gene is a member of the monocarboxylate transporter family. Members in this family transport metabolites, such as lactate, pyruvate, and ketone bodies. The protein encoded by this gene catalyzes the proton-linked transport of monocarboxylates and has the highest affinity for pyruvate. This protein has been reported to be more highly expressed in prostate and colorectal cancer specimens when compared to control specimens. Alternative splicing results in multiple transcript variants.
Product Categories/Family for SLC16A7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
monocarboxylate transporter 2
NCBI Official Synonym Full Names
solute carrier family 16 member 7
NCBI Official Symbol
SLC16A7
NCBI Official Synonym Symbols
MCT2
NCBI Protein Information
monocarboxylate transporter 2
UniProt Protein Name
Monocarboxylate transporter 2
UniProt Gene Name
SLC16A7
UniProt Synonym Gene Names
MCT2; MCT 2
UniProt Entry Name
MOT2_HUMAN

NCBI Description

This gene is a member of the monocarboxylate transporter family. Members in this family transport metabolites, such as lactate, pyruvate, and ketone bodies. The protein encoded by this gene catalyzes the proton-linked transport of monocarboxylates and has the highest affinity for pyruvate. This protein has been reported to be more highly expressed in prostate and colorectal cancer specimens when compared to control specimens. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]

Uniprot Description

SLC16A7: Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. MCT2 is a high affinity pyruvate transporter. Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.

Protein type: Membrane protein, multi-pass; Transporter, SLC family; Transporter; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: pyruvate secondary active transmembrane transporter activity; symporter activity; lactate transmembrane transporter activity; secondary active monocarboxylate transmembrane transporter activity; pyruvate transmembrane transporter activity

Biological Process: transmembrane transport

Research Articles on SLC16A7

Similar Products

Product Notes

The SLC16A7 slc16a7 (Catalog #AAA3247817) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC16A7 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQPALTIIGK YFYRKRPMAN GLAMAGSPVF LSSLAPFNQY LFNTFGWKGS. It is sometimes possible for the material contained within the vial of "SLC16A7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.