SIM1 blocking peptide
SIM1 Peptide - middle region
Gene Names
SIM1; bHLHe14
Reactivity
Human
Applications
Immunohistochemistry
Synonyms
SIM1; SIM1 Peptide - middle region; SIM1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR
Sequence Length
766
Applicable Applications for SIM1 blocking peptide
Immunohistochemistry (IHC)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SIM1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SIM1 Antibody, made
Target Description: SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. SIM1 transcript was detected only in fetal kidney out of various adult and fetal tissues tested. Since the sim gene plays an important role in Drosophila development and has peak levels of expression during the period of neurogenesis,it was proposed that the human SIM gene is a candidate for involvement in certain dysmorphic features (particularly the facial and skull characteristics), abnormalities of brain development, and/or mental retardation of Down syndrome.
Target Description: SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. SIM1 transcript was detected only in fetal kidney out of various adult and fetal tissues tested. Since the sim gene plays an important role in Drosophila development and has peak levels of expression during the period of neurogenesis,it was proposed that the human SIM gene is a candidate for involvement in certain dysmorphic features (particularly the facial and skull characteristics), abnormalities of brain development, and/or mental retardation of Down syndrome.
Product Categories/Family for SIM1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
single-minded homolog 1
NCBI Official Synonym Full Names
SIM bHLH transcription factor 1
NCBI Official Symbol
SIM1
NCBI Official Synonym Symbols
bHLHe14
NCBI Protein Information
single-minded homolog 1
UniProt Protein Name
Single-minded homolog 1
Protein Family
UniProt Gene Name
SIM1
UniProt Synonym Gene Names
BHLHE14; bHLHe14
UniProt Entry Name
SIM1_HUMAN
NCBI Description
SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. SIM1 transcript was detected only in fetal kidney out of various adult and fetal tissues tested. Since the sim gene plays an important role in Drosophila development and has peak levels of expression during the period of neurogenesis,it was proposed that the human SIM gene is a candidate for involvement in certain dysmorphic features (particularly the facial and skull characteristics), abnormalities of brain development, and/or cognitive disability of Down syndrome. [provided by RefSeq, Jul 2008]
Research Articles on SIM1
Similar Products
Product Notes
The SIM1 sim1 (Catalog #AAA3226452) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SIM1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SIM1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the SIM1 sim1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SSSKSKSRTS PYPQYSGFHT ERSESDHDSQ WGGSPLTDTA SPQLLDPADR. It is sometimes possible for the material contained within the vial of "SIM1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
