Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SIGMAR1 blocking peptide

SIGMAR1 Peptide - middle region

Gene Names
SIGMAR1; SRBP; ALS16; DSMA2; OPRS1; SR-BP; SIG-1R; SR-BP1; sigma1R; hSigmaR1
Reactivity
Human
Applications
Western Blot
Synonyms
SIGMAR1; SIGMAR1 Peptide - middle region; SIGMAR1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGL
Sequence Length
223
Applicable Applications for SIGMAR1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SIGMAR1 blocking peptide
This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.
Product Categories/Family for SIGMAR1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
sigma non-opioid intracellular receptor 1 isoform 6
NCBI Official Synonym Full Names
sigma non-opioid intracellular receptor 1
NCBI Official Symbol
SIGMAR1
NCBI Official Synonym Symbols
SRBP; ALS16; DSMA2; OPRS1; SR-BP; SIG-1R; SR-BP1; sigma1R; hSigmaR1
NCBI Protein Information
sigma non-opioid intracellular receptor 1
UniProt Protein Name
Sigma non-opioid intracellular receptor 1
UniProt Gene Name
SIGMAR1
UniProt Synonym Gene Names
OPRS1; SRBP; SR-BP; SIG-1R; Sigma1-receptor; Sigma1R; hSigmaR1
UniProt Entry Name
SGMR1_HUMAN

NCBI Description

This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeq, Aug 2013]

Uniprot Description

SIGMAR1: Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane. Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration. Defects in SIGMAR1 are the cause of amyotrophic lateral sclerosis type 16, juvenile (ALS16). ALS16 is a neurodegenerative disorder affecting upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. Sensory abnormalities are absent. The pathologic hallmarks of the disease include pallor of the corticospinal tract due to loss of motor neurons, presence of ubiquitin-positive inclusions within surviving motor neurons, and deposition of pathologic aggregates. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5- 10% of the cases. Belongs to the ERG2 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear envelope; Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: nuclear outer membrane; endoplasmic reticulum membrane; growth cone; integral to plasma membrane; integral to membrane; nuclear inner membrane; nuclear envelope; lipid particle; cell junction

Molecular Function: opioid receptor activity; drug binding

Biological Process: nervous system development; regulation of neuron apoptosis; lipid transport

Disease: Amyotrophic Lateral Sclerosis 16, Juvenile

Research Articles on SIGMAR1

Similar Products

Product Notes

The SIGMAR1 sigmar1 (Catalog #AAA3245677) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SIGMAR1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SIGMAR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SIGMAR1 sigmar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVEWGPNTWM VEYGRGVIPS TLAFALADTV FSTQDFLTLF YTLRSYARGL. It is sometimes possible for the material contained within the vial of "SIGMAR1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.