Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SH3BP4 blocking peptide

SH3BP4 Peptide - N-terminal region

Gene Names
SH3BP4; TTP; BOG25
Reactivity
Human
Applications
Western Blot
Synonyms
SH3BP4; SH3BP4 Peptide - N-terminal region; SH3BP4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS
Sequence Length
963
Applicable Applications for SH3BP4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SH3BP4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SH3BP4 Antibody, made

Target Description: This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.
Product Categories/Family for SH3BP4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107kDa
NCBI Official Full Name
SH3 domain-binding protein 4
NCBI Official Synonym Full Names
SH3 domain binding protein 4
NCBI Official Symbol
SH3BP4
NCBI Official Synonym Symbols
TTP; BOG25
NCBI Protein Information
SH3 domain-binding protein 4
UniProt Protein Name
SH3 domain-binding protein 4
UniProt Gene Name
SH3BP4
UniProt Synonym Gene Names
BOG25; EHB10; TTP
UniProt Entry Name
SH3B4_HUMAN

NCBI Description

This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

SH3BP4: Functions in transferrin receptor internalization at the plasma membrane through a cargo-specific control of clathrin- mediated endocytosis. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Cell cycle regulation

Chromosomal Location of Human Ortholog: 2q37.1-q37.2

Cellular Component: clathrin-coated vesicle; cytoplasm; coated pit; nucleus

Molecular Function: identical protein binding; protein binding; Ras GTPase binding; GDP-dissociation inhibitor activity

Biological Process: negative regulation of cell proliferation; negative regulation of TOR signaling pathway; regulation of catalytic activity; endocytosis; negative regulation of cell growth; positive regulation of autophagy; amino acid import

Research Articles on SH3BP4

Similar Products

Product Notes

The SH3BP4 sh3bp4 (Catalog #AAA3236985) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SH3BP4 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SH3BP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SH3BP4 sh3bp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FTTLKFSKGD HLYVLDTSGG EWWYAHNTTE MGYIPSSYVQ PLNYRNSTLS. It is sometimes possible for the material contained within the vial of "SH3BP4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.