Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SEPT2 blocking peptide

SEPT2 Peptide - C-terminal region

Gene Names
SEPT2; DIFF6; NEDD5; NEDD-5; Pnutl3; hNedd5
Reactivity
Human
Synonyms
SEPT2; SEPT2 Peptide - C-terminal region; SEPT2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: THMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRR
Sequence Length
361
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SEPT2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SEPT2 Antibody, made

Target Description: SEPT2 is a filament-forming cytoskeletal GTPase. It is required for normal organization of the actin cytoskeleton. It plays a role in the biogenesis of polarized columnar-shaped epithelium by maintaining polyglutamylated microtubules, thus facilitating efficient vesicle transport, and by impeding MAP4 binding to tubulin. It is required for the progression through mitosis. Forms a scaffold at the midplane of the mitotic splindle required to maintain CENPE localization at kinetochores and consequently chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. It plays a role in ciliogenesis and collective cell movements. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes: probably acts by regulating the assembly of the tectonic-like complex (also named B9 complex) by localizing TMEM231 protein. It may play a role in the internalization of 2 intracellular microbial pathogens, Listeria monocytogenes and Shigella flexneri.
Product Categories/Family for SEPT2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Synonym Full Names
septin 2
NCBI Official Symbol
SEPT2
NCBI Official Synonym Symbols
DIFF6; NEDD5; NEDD-5; Pnutl3; hNedd5
NCBI Protein Information
septin-2
UniProt Protein Name
Septin-2
UniProt Gene Name
SEPT2
UniProt Synonym Gene Names
DIFF6; KIAA0158; NEDD5; NEDD-5
UniProt Entry Name
SEPT2_HUMAN

Uniprot Description

SEPT2: a member of the septin family of proteins. May be involved in the process of cytokinesis. Accumulates near the contractile ring from anaphase through telophase, and finally condenses into the midbody. In interphase and postmitotic cells, localized to fibrous or granular structures, depending on the growth state of the cell.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis; Cell development/differentiation; Cell cycle regulation; Hydrolase

Chromosomal Location of Human Ortholog: 2q37

Cellular Component: nucleoplasm; perinuclear region of cytoplasm; cytoplasm; nucleolus; exocyst; synapse; spindle; midbody; cell cortex; nucleus; actin cytoskeleton; cleavage furrow

Molecular Function: protein binding; GTP binding; protein complex scaffold; enzyme regulator activity

Biological Process: mitosis; smoothened signaling pathway; regulation of protein localization; cell division; regulation of catalytic activity; cilium biogenesis; regulation of L-glutamate transport; neurite development

Research Articles on SEPT2

Similar Products

Product Notes

The SEPT2 sept2 (Catalog #AAA3244753) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SEPT2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: THMQDLQEVT QDLHYENFRS ERLKRGGRKV ENEDMNKDQI LLEKEAELRR. It is sometimes possible for the material contained within the vial of "SEPT2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.