Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SCG5 blocking peptide

SCG5 Peptide - C-terminal region

Gene Names
SCG5; 7B2; SgV; P7B2; SGNE1
Reactivity
Human
Applications
Western Blot
Synonyms
SCG5; SCG5 Peptide - C-terminal region; SCG5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
QHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVA
Sequence Length
212
Applicable Applications for SCG5 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SCG5 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SCG5 Antibody, made

Target Description: SCG5 acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. SCG5 binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. SCG5 is also required for cleavage of PCSK2 but does not appear to be involved in its folding. SCG5 plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.
Product Categories/Family for SCG5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
neuroendocrine protein 7B2 isoform 1
NCBI Official Synonym Full Names
secretogranin V
NCBI Official Symbol
SCG5
NCBI Official Synonym Symbols
7B2; SgV; P7B2; SGNE1
NCBI Protein Information
neuroendocrine protein 7B2
UniProt Protein Name
Neuroendocrine protein 7B2
Protein Family
UniProt Gene Name
SCG5
UniProt Synonym Gene Names
SGNE1
UniProt Entry Name
7B2_HUMAN

NCBI Description

This gene encodes a secreted chaperone protein that prevents the aggregation of other secreted proteins, including proteins that are associated with neurodegenerative and metabolic disease. The encoded protein may be best known for its role in the trafficking and activation of prohormone convertase PC2 (encoded by Gene ID: 5126). Phosphorylation of the encoded protein has been shown to have an inhibitory effect on its chaperone function. This gene also produces a ARHGAP11A-SCG5 readthrough transcript and ARHGAP11A-SCG5 protein. [provided by RefSeq, Feb 2019]

Uniprot Description

7B2: Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro. Belongs to the 7B2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Chaperone

Chromosomal Location of Human Ortholog: 15q13-q14

Cellular Component: extracellular region; secretory granule

Molecular Function: enzyme inhibitor activity; protein binding; GTP binding; unfolded protein binding

Biological Process: intracellular protein transport; neuropeptide signaling pathway; peptide hormone processing; negative regulation of catalytic activity; regulation of hormone secretion

Research Articles on SCG5

Similar Products

Product Notes

The SCG5 scg5 (Catalog #AAA3241092) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SCG5 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCG5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SCG5 scg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QHLFDPEHDY PGLGKWNKKL LYEKMKGGER RKRRSVNPYL QGQRLDNVVA. It is sometimes possible for the material contained within the vial of "SCG5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.