Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ROR1 blocking peptide

ROR1 Peptide - N-terminal region

Gene Names
ROR1; NTRKR1; dJ537F10.1
Reactivity
Human
Applications
Western Blot
Synonyms
ROR1; ROR1 Peptide - N-terminal region; ROR1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITA
Sequence Length
937
Applicable Applications for ROR1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ROR1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ROR1 Antibody, made

Target Description: The protein encoded by this gene is a receptor protein tyrosine kinase that modulates neurite growth in the central nervous system. It is a type I membrane protein and belongs to the ROR subfamily of cell surface receptors. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for ROR1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
104kDa
NCBI Official Full Name
inactive tyrosine-protein kinase transmembrane receptor ROR1 isoform 1
NCBI Official Synonym Full Names
receptor tyrosine kinase like orphan receptor 1
NCBI Official Symbol
ROR1
NCBI Official Synonym Symbols
NTRKR1; dJ537F10.1
NCBI Protein Information
inactive tyrosine-protein kinase transmembrane receptor ROR1
UniProt Protein Name
Tyrosine-protein kinase transmembrane receptor ROR1
UniProt Gene Name
ROR1
UniProt Synonym Gene Names
NTRKR1
UniProt Entry Name
ROR1_HUMAN

NCBI Description

This gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. It is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signalling pathway. This gene is highly expressed during early embryonic development but expressed at very low levels in adult tissues. Increased expression of this gene is associated with B-cell chronic lymphocytic leukaemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2012]

Uniprot Description

ROR1: Tyrosine-protein kinase receptor whose role is not yet clear. Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm. Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.10.1; Protein kinase, tyrosine (receptor); Membrane protein, integral; Protein kinase, TK; Kinase, protein; TK group; Ror family

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane; receptor complex

Molecular Function: Wnt-protein binding; protein binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: peptidyl-tyrosine phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on ROR1

Similar Products

Product Notes

The ROR1 ror1 (Catalog #AAA3241124) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ROR1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ROR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ROR1 ror1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TASPGYSDEY EEDGFCQPYR GIACARFIGN RTVYMESLHM QGEIENQITA. It is sometimes possible for the material contained within the vial of "ROR1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.