Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RND2 blocking peptide

RND2 Peptide - middle region

Gene Names
RND2; ARHN; RHO7; RhoN
Reactivity
Human
Synonyms
RND2; RND2 Peptide - middle region; RND2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCN
Sequence Length
227
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RND2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- RND2 Antibody, made

Target Description: This gene encodes a member of the Rho GTPase family, whose members play a key role in the regulation of actin cytoskeleton organization in response to extracellular growth factors. This particular family member has been implicated in the regulation of neuronal morphology and endosomal trafficking. The gene localizes to chromosome 17 and is the centromeric neighbor of the breast-ovarian cancer susceptibility gene BRCA1.
Product Categories/Family for RND2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
rho-related GTP-binding protein RhoN
NCBI Official Synonym Full Names
Rho family GTPase 2
NCBI Official Symbol
RND2
NCBI Official Synonym Symbols
ARHN; RHO7; RhoN
NCBI Protein Information
rho-related GTP-binding protein RhoN
UniProt Protein Name
Rho-related GTP-binding protein RhoN
UniProt Gene Name
RND2
UniProt Synonym Gene Names
ARHN; RHO7
UniProt Entry Name
RND2_HUMAN

NCBI Description

This gene encodes a member of the Rho GTPase family, whose members play a key role in the regulation of actin cytoskeleton organization in response to extracellular growth factors. This particular family member has been implicated in the regulation of neuronal morphology and endosomal trafficking. The gene localizes to chromosome 17 and is the centromeric neighbor of the breast-ovarian cancer susceptibility gene BRCA1. [provided by RefSeq, Jul 2008]

Uniprot Description

RND2: May be specifically involved in neuronal and hepatic functions. Is a C3 toxin-insensitive member of the Rho subfamily. Belongs to the small GTPase superfamily. Rho family.

Protein type: G protein, monomeric; G protein; G protein, monomeric, Rho

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: early endosome; acrosomal membrane

Molecular Function: GTPase activity; protein binding; GTP binding; protein N-terminus binding

Biological Process: metabolic process; small GTPase mediated signal transduction; signal transduction; positive regulation of collateral sprouting

Research Articles on RND2

Similar Products

Product Notes

The RND2 rnd2 (Catalog #AAA3247231) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RND2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VATVASLGRG HRQLRRTDSR RGMQRSAQLS GRPDRGNEGE IHKDRAKSCN. It is sometimes possible for the material contained within the vial of "RND2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.