Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RND1 blocking peptide

RND1 Peptide - C-terminal region

Gene Names
RND1; ARHS; RHO6; RHOS
Reactivity
Human
Applications
Western Blot
Synonyms
RND1; RND1 Peptide - C-terminal region; RND1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
ASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Sequence Length
232
Applicable Applications for RND1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RND1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-RND1 Antibody, made

Target Description: Members of the Rho GTPase family, such as RND1, regulate the organization of the actin cytoskeleton in response to extracellular growth factors.
Product Categories/Family for RND1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
rho-related GTP-binding protein Rho6
NCBI Official Synonym Full Names
Rho family GTPase 1
NCBI Official Symbol
RND1
NCBI Official Synonym Symbols
ARHS; RHO6; RHOS
NCBI Protein Information
rho-related GTP-binding protein Rho6
UniProt Protein Name
Rho-related GTP-binding protein Rho6
UniProt Gene Name
RND1
UniProt Synonym Gene Names
RHO6
UniProt Entry Name
RND1_HUMAN

NCBI Description

This gene encodes a protein that belongs to the Rho GTPase family. Members of this family regulate the organization of the actin cytoskeleton in response to extracellular growth factors. A similar protein in rat interacts with a microtubule regulator to control axon extension. [provided by RefSeq, Apr 2014]

Uniprot Description

RND1: Lacks intrinsic GTPase activity. Has a low affinity for GDP, and constitutively binds GTP. Controls rearrangements of the actin cytoskeleton. Induces the Rac-dependent neuritic process formation in part by disruption of the cortical actin filaments. Causes the formation of many neuritic processes from the cell body with disruption of the cortical actin filaments. Belongs to the small GTPase superfamily. Rho family.

Protein type: G protein, monomeric, Rho; G protein, monomeric; G protein

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: cytoskeleton; adherens junction; plasma membrane; cytosol

Molecular Function: GTPase activity; protein binding; GTP binding; receptor binding

Biological Process: axon guidance; metabolic process; small GTPase mediated signal transduction; actin filament organization; negative regulation of cell adhesion; neuron remodeling

Research Articles on RND1

Similar Products

Product Notes

The RND1 rnd1 (Catalog #AAA3240193) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RND1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RND1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RND1 rnd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASMLCLNKPS PLPQKSPVRS LSKRLLHLPS RSELISSTFK KEKAKSCSIM. It is sometimes possible for the material contained within the vial of "RND1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.