Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RGS14 blocking peptide

RGS14 Peptide - C-terminal region

Reactivity
Human
Synonyms
RGS14; RGS14 Peptide - C-terminal region; RGS14 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQ
Sequence Length
347
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RGS14 blocking peptide
This is a synthetic peptide designed for use in combination with anti- RGS14 Antibody, made

Target Description: This gene encodes a member of the regulator of G-protein signaling family. This protein contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Product Categories/Family for RGS14 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
regulator of G-protein signaling 14 isoform 1
NCBI Official Synonym Full Names
regulator of G protein signaling 14
NCBI Official Symbol
RGS14
NCBI Protein Information
regulator of G-protein signaling 14
UniProt Protein Name
Regulator of G-protein signaling 14
UniProt Gene Name
RGS14
UniProt Synonym Gene Names
RGS14
UniProt Entry Name
RGS14_HUMAN

NCBI Description

This gene encodes a member of the regulator of G-protein signaling family. This protein contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

RGS14: Acts as a regulator of G protein signaling (RGS). Modulates G protein alpha subunits nucleotide exchange and hydrolysis activities by functioning either as a GTPase-activating protein (GAP), thereby driving G protein alpha subunits into their inactive GDP-bound form, or as a GDP-dissociation inhibitor (GDI). Confers GDI activity on G(i) alpha subunits GNAI1 and GNAI3, but not G(o) alpha subunit GNAO1 and G(i) alpha subunit GNAI2. Confers GAP activity on G(o) alpha subunit GNAI0 and G(i) alpha subunits GNAI2 and GNAI3. May act as a scaffold integrating G protein and Ras/Raf MAPkinase signaling pathways. Inhibits platelet-derived growth factor (PDGF)-stimulated ERK1/ERK2 phosphorylation; a process depending on its interaction with HRAS1 and that is reversed by G(i) alpha subunit GNAI1. Acts as a positive modulator of microtubule polymerisation and spindle organization through a G(i)-alpha-dependent mechanism. Plays a role in cell division. Probably required for the nerve growth factor (NGF)-mediated neurite outgrowth. May be involved in visual memory processing capacity and hippocampal-based learning and memory. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs; GAPs, RGS

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: spindle pole; centrosome; microtubule; PML body; dendrite; postsynaptic density; dendritic spine; nuclear body; postsynaptic membrane; cytoplasm; plasma membrane; spindle; nucleus; cell junction

Molecular Function: receptor signaling complex scaffold activity; microtubule binding; GDP-dissociation inhibitor activity; receptor signaling protein activity; GTPase activating protein binding; G-protein alpha-subunit binding; protein kinase binding; GTPase activator activity

Biological Process: regulation of transcription in response to stress; negative regulation of MAP kinase activity; mitosis; zygote asymmetric cell division; positive regulation of neurogenesis; negative regulation of synaptic plasticity; platelet-derived growth factor receptor signaling pathway; nucleocytoplasmic transport; learning; spindle organization and biogenesis; chromosome segregation; long-term memory; cell division; visual learning; response to oxidative stress; regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity

Research Articles on RGS14

Similar Products

Product Notes

The RGS14 rgs14 (Catalog #AAA3247180) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RGS14 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELLNRVQSSG AHDQRGLLRK EDLVLPEFLQ LPAQGPSSEE TPPQTKSAAQ. It is sometimes possible for the material contained within the vial of "RGS14, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.