Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RBMX blocking peptide

RBMX Peptide - C-terminal region

Gene Names
RBMX; RNMX; HNRPG; HNRNPG; MRXS11; RBMXP1; RBMXRT; hnRNP-G
Reactivity
Human
Applications
Western Blot
Synonyms
RBMX; RBMX Peptide - C-terminal region; RBMX blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS
Sequence Length
391
Applicable Applications for RBMX blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RBMX blocking peptide
This is a synthetic peptide designed for use in combination with anti-RBMX Antibody, made

Target Description: This gene belongs to the RBMY gene family which includes candidate Y chromosome spermatogenesis genes. This gene, an active X chromosome homolog of the Y chromosome RBMY gene, is widely expressed whereas the RBMY gene evolved a male-specific function in spermatogenesis. Pseudogenes of this gene, found on chromosomes 1, 4, 9, 11, and 6, were likely derived by retrotransposition from the original gene. Alternatively spliced transcript variants encoding different isoforms have been identified. A snoRNA gene (SNORD61) is found in one of its introns.
Product Categories/Family for RBMX blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
RNA-binding motif protein, X chromosome isoform 1
NCBI Official Synonym Full Names
RNA binding motif protein X-linked
NCBI Official Symbol
RBMX
NCBI Official Synonym Symbols
RNMX; HNRPG; HNRNPG; MRXS11; RBMXP1; RBMXRT; hnRNP-G
NCBI Protein Information
RNA-binding motif protein, X chromosome
UniProt Protein Name
RNA-binding motif protein, X chromosome
Protein Family
UniProt Gene Name
RBMX
UniProt Synonym Gene Names
HNRPG; RBMXP1; hnRNP G
UniProt Entry Name
RBMX_HUMAN

NCBI Description

This gene belongs to the RBMY gene family which includes candidate Y chromosome spermatogenesis genes. This gene, an active X chromosome homolog of the Y chromosome RBMY gene, is widely expressed whereas the RBMY gene evolved a male-specific function in spermatogenesis. Pseudogenes of this gene, found on chromosomes 1, 4, 9, 11, and 6, were likely derived by retrotransposition from the original gene. Alternatively spliced transcript variants encoding different isoforms have been identified. A snoRNA gene (SNORD61) is found in one of its introns. [provided by RefSeq, Sep 2009]

Uniprot Description

RBMX: RNA-binding protein that plays several role in the regulation of pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing of several pre-mRNAs. Binds to and stimulates transcription from the tumor suppressor TXNIP gene promoter; may thus be involved in tumor suppression. When associated with SAFB, binds to and stimulates transcription from the SREBF1 promoter. Associates with nascent mRNAs transcribed by RNA polymerase II. Component of the supraspliceosome complex that regulates pre-mRNA alternative splice site selection. Can either activate or suppress exon inclusion; acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN2. Represses the splicing of MAPT/Tau exon 10. Binds preferentially to single- stranded 5'-CC[A/C]-rich RNA sequence motifs localized in a single-stranded conformation; probably binds RNA as a homodimer. Binds non-specifically to pre-mRNAs. Plays also a role in the cytoplasmic TNFR1 trafficking pathways; promotes both the IL-1- beta-mediated inducible proteolytic cleavage of TNFR1 ectodomains and the release of TNFR1 exosome-like vesicles to the extracellular compartment. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; RNA processing; Tumor suppressor; RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: Xq26.3

Cellular Component: nucleoplasm; extracellular space; membrane; nucleus; ribonucleoprotein complex

Molecular Function: mRNA binding; protein binding; RNA binding; nucleotide binding; chromatin binding

Biological Process: positive regulation of nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase II promoter; osteoblast differentiation; nuclear mRNA splicing, via spliceosome; negative regulation of nuclear mRNA splicing, via spliceosome; RNA splicing; membrane protein ectodomain proteolysis; gene expression; positive regulation of transcription from RNA polymerase II promoter; regulation of alternative nuclear mRNA splicing, via spliceosome; protein homooligomerization

Research Articles on RBMX

Similar Products

Product Notes

The RBMX rbmx (Catalog #AAA3240254) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RBMX Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBMX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBMX rbmx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SSSRDGYGGS RDSYSSSRSD LYSSGRDRVG RQERGLPPSM ERGYPPPRDS. It is sometimes possible for the material contained within the vial of "RBMX, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.