Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

QTRT2 blocking peptide

QTRT2 Peptide - middle region

Gene Names
QTRT2; QTRTD1
Reactivity
Human
Synonyms
QTRT2; QTRT2 Peptide - middle region; QTRT2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SFDYQPNPEETLLQQNGTQEEIKCMDQIKKIETTGCNQEITSFEINLKEK
Sequence Length
415
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for QTRT2 blocking peptide
This gene encodes a subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine, and tyrosine. The encoded protein may play a role in the queuosine 5'-monophosphate salvage pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for QTRT2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
queuine tRNA-ribosyltransferase accessory subunit 2 isoform 2
NCBI Official Synonym Full Names
queuine tRNA-ribosyltransferase accessory subunit 2
NCBI Official Symbol
QTRT2
NCBI Official Synonym Symbols
QTRTD1
NCBI Protein Information
queuine tRNA-ribosyltransferase accessory subunit 2
UniProt Protein Name
Queuine tRNA-ribosyltransferase subunit QTRTD1
UniProt Gene Name
QTRTD1
UniProt Entry Name
QTRD1_HUMAN

NCBI Description

This gene encodes a subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine, and tyrosine. The encoded protein may play a role in the queuosine 5'-monophosphate salvage pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

QTRTD1: Interacts with QTRT1 to form an active queuine tRNA- ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1- yl)amino)methyl)-7-deazaguanosine). Belongs to the queuine tRNA-ribosyltransferase family. QTRTD1 subfamily.

Protein type: EC 2.4.2.29

Chromosomal Location of Human Ortholog: 3q13.31

Cellular Component: cytoplasm; mitochondrial outer membrane; mitochondrion

Molecular Function: protein heterodimerization activity; protein homodimerization activity; queuine tRNA-ribosyltransferase activity

Biological Process: queuosine biosynthetic process; tRNA modification

Research Articles on QTRT2

Similar Products

Product Notes

The QTRT2 qtrtd1 (Catalog #AAA3246875) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The QTRT2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFDYQPNPEE TLLQQNGTQE EIKCMDQIKK IETTGCNQEI TSFEINLKEK. It is sometimes possible for the material contained within the vial of "QTRT2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.