Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

QKI blocking peptide

QKI Peptide - middle region

Gene Names
QKI; QK; Hqk; QK1; QK3; hqkI
Reactivity
Human
Synonyms
QKI; QKI Peptide - middle region; QKI blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAV
Sequence Length
317
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for QKI blocking peptide
This is a synthetic peptide designed for use in combination with anti- QKI Antibody, made

Target Description: The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for QKI blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
protein quaking isoform 1
NCBI Official Synonym Full Names
QKI, KH domain containing RNA binding
NCBI Official Symbol
QKI
NCBI Official Synonym Symbols
QK; Hqk; QK1; QK3; hqkI
NCBI Protein Information
protein quaking
UniProt Protein Name
Protein quaking
Protein Family
UniProt Gene Name
QKI
UniProt Synonym Gene Names
HKQ; Hqk; HqkI
UniProt Entry Name
QKI_HUMAN

NCBI Description

The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]

Uniprot Description

QKI: RNA-binding protein that plays a central role in myelinization. Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Acts by regulating pre-mRNA splicing, mRNA export, mRNA stability and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia. Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor. 6 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 6q26

Cellular Component: cytoplasm; nucleus

Molecular Function: mRNA binding; protein binding; SH3 domain binding

Biological Process: myelination; regulation of translation; muscle cell differentiation; mRNA transport; RNA splicing; long-chain fatty acid biosynthetic process; mRNA processing; vasculogenesis; spermatid development

Research Articles on QKI

Similar Products

Product Notes

The QKI qki (Catalog #AAA3246408) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The QKI Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRGKGSMRDK KKEEQNRGKP NWEHLNEDLH VLITVEDAQN RAEIKLKRAV. It is sometimes possible for the material contained within the vial of "QKI, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.