Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PTK2 blocking peptide

PTK2 Peptide - middle region

Reactivity
Human
Applications
Western Blot
Synonyms
PTK2; PTK2 Peptide - middle region; PTK2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRER IELGRC
Sequence Length
431
Applicable Applications for PTK2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PTK2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PTK2 Antibody, made

Target Description: This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene, but the full-length natures of only three of them have been determined.
Product Categories/Family for PTK2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
UniProt Protein Name
Focal adhesion kinase 1
Protein Family
UniProt Gene Name
PTK2
UniProt Synonym Gene Names
FAK; FAK1; FADK 1; FRNK; PPP1R71
UniProt Entry Name
FAK1_HUMAN

Uniprot Description

FAK: a tyrosine kinase of the FAK family required for cell migration and contact-dependent survival signaling. Activated by tyrosine-phosphorylation in response to either integrin clustering induced by cell adhesion or antibody cross-linking, or via G-protein coupled receptor (GPCR) occupancy by ligands such as bombesin or lysophosphatidic acid, or via LDL receptor occupancy. Downstream of integrins and Src, upstream of Ras/MAPK. Localizes to focal adhesions that form between cells growing in the presence of extracellular matrix constituents. Interacts with CAS family members and with GIT1, SORBS1 and BCAR3. Interacts with Shb. Required for full Ras transformation of fibroblasts. Increased expression in breast and other cancers, related to chromosome 8q amplification. Overexpression and activation associated with increased migration, invasion and progression of ovarian cancer, and with progression in hepatocellular carcinoma, thyroid cancer, and acute myelogenous leukemia. siRNA increases chemosensitivity of pancreatic adenocarcinoma xenografts. Inhibitor: ISI15421 (antisense). Four splice-variant isoforms have been observed.

Protein type: Protein kinase, TK; Kinase, protein; EC 2.7.10.2; Protein kinase, tyrosine (non-receptor); TK group; Fak family

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: extrinsic to internal side of plasma membrane; focal adhesion; cytoskeleton; lamellipodium; cytoplasm; apical plasma membrane; stress fiber; plasma membrane; microtubule organizing center; cell cortex; cytosol; nucleus

Molecular Function: JUN kinase binding; protein binding; signal transducer activity; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; SH2 domain binding; actin binding; protein kinase binding; ATP binding; receptor binding; protein kinase activity

Biological Process: heart morphogenesis; axon guidance; extracellular matrix organization and biogenesis; establishment of nucleus localization; peptidyl-tyrosine phosphorylation; apoptosis; protein amino acid autophosphorylation; cell motility involved in cell locomotion; neuron migration; negative regulation of synaptogenesis; regulation of cell shape; regulation of cell adhesion mediated by integrin; transforming growth factor beta receptor signaling pathway; positive regulation of cell proliferation; ephrin receptor signaling pathway; negative regulation of axonogenesis; angiogenesis; vasculogenesis; cell structure disassembly during apoptosis; placenta development; integrin-mediated signaling pathway; epidermal growth factor receptor signaling pathway; platelet activation; regulation of osteoblast differentiation; central nervous system neuron axonogenesis; signal complex assembly; positive regulation of phosphoinositide 3-kinase activity; cytoskeleton organization and biogenesis; microtubule cytoskeleton organization and biogenesis; negative regulation of organ growth; regulation of cell proliferation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; embryonic development; establishment of cell polarity; positive regulation of protein kinase activity; regulation of focal adhesion formation; endothelial cell migration; innate immune response; positive regulation of protein amino acid phosphorylation; negative regulation of cell-cell adhesion; blood coagulation; vascular endothelial growth factor receptor signaling pathway; positive regulation of cell migration; regulation of cytoskeleton organization and biogenesis; negative regulation of apoptosis

Similar Products

Product Notes

The PTK2 ptk2 (Catalog #AAA3243532) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PTK2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTK2 ptk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEKQGMRTHA VSVSETDDYA EIIDEEDTYT MPSTRDYEIQ RER IELGRC. It is sometimes possible for the material contained within the vial of "PTK2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.