Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PTH2R blocking peptide

PTH2R Peptide - C-terminal region

Gene Names
PTH2R; PTHR2
Reactivity
Human
Applications
Western Blot
Synonyms
PTH2R; PTH2R Peptide - C-terminal region; PTH2R blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED
Sequence Length
550
Applicable Applications for PTH2R blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PTH2R blocking peptide
This is a synthetic peptide designed for use in combination with anti-PTH2R Antibody, made

Target Description: The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH). This receptor is more selective in ligand recognition and has a more specific tissue distribution compared to parathyroid hormone receptor 1 (PTHR1). It is activated only by PTH and not by parathyroid hormone-like hormone (PTHLH) and is particularly abundant in brain and pancreas.
Product Categories/Family for PTH2R blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
parathyroid hormone 2 receptor isoform 1
NCBI Official Synonym Full Names
parathyroid hormone 2 receptor
NCBI Official Symbol
PTH2R
NCBI Official Synonym Symbols
PTHR2
NCBI Protein Information
parathyroid hormone 2 receptor
UniProt Protein Name
Parathyroid hormone 2 receptor
UniProt Gene Name
PTH2R
UniProt Synonym Gene Names
PTHR2; PTH2 receptor
UniProt Entry Name
PTH2R_HUMAN

NCBI Description

The protein encoded by this gene is a member of the G-protein coupled receptor 2 family. This protein is a receptor for parathyroid hormone (PTH). This receptor is more selective in ligand recognition and has a more specific tissue distribution compared to parathyroid hormone receptor 1 (PTHR1). It is activated only by PTH and not by parathyroid hormone-like hormone (PTHLH) and is particularly abundant in brain and pancreas. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

PTH2R: This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor. Belongs to the G-protein coupled receptor 2 family.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 2; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q33

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: parathyroid hormone receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway

Research Articles on PTH2R

Similar Products

Product Notes

The PTH2R pth2r (Catalog #AAA3241498) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PTH2R Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTH2R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTH2R pth2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NSEQDCLPHS FHEETKEDSG RQGDDILMEK PSRPMESNPD TEGCQGETED. It is sometimes possible for the material contained within the vial of "PTH2R, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.