Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PSMD6 blocking peptide

PSMD6 Peptide - C-terminal region

Gene Names
PSMD6; S10; Rpn7; p42A; p44S10; SGA-113M
Reactivity
Human
Synonyms
PSMD6; PSMD6 Peptide - C-terminal region; PSMD6 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDL
Sequence Length
351
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PSMD6 blocking peptide
This is a synthetic peptide designed for use in combination with anti- PSMD6 Antibody, made

Target Description: This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants
Product Categories/Family for PSMD6 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
26S proteasome non-ATPase regulatory subunit 6 isoform 1
NCBI Official Synonym Full Names
proteasome 26S subunit, non-ATPase 6
NCBI Official Symbol
PSMD6
NCBI Official Synonym Symbols
S10; Rpn7; p42A; p44S10; SGA-113M
NCBI Protein Information
26S proteasome non-ATPase regulatory subunit 6
UniProt Protein Name
26S proteasome non-ATPase regulatory subunit 6
UniProt Gene Name
PSMD6
UniProt Synonym Gene Names
KIAA0107; PFAAP4
UniProt Entry Name
PSMD6_HUMAN

NCBI Description

This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012]

Uniprot Description

PSMD6: Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. Belongs to the proteasome subunit S10 family.

Chromosomal Location of Human Ortholog: 3p14.1

Cellular Component: nucleoplasm; proteasome complex; proteasome regulatory particle; cytosol

Molecular Function: ATPase activity

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; proteasomal ubiquitin-dependent protein catabolic process; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; viral reproduction; apoptosis; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; proteolysis; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; negative regulation of apoptosis; G1/S transition of mitotic cell cycle

Research Articles on PSMD6

Similar Products

Product Notes

The PSMD6 psmd6 (Catalog #AAA3246734) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PSMD6 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVEFIDQELS RFIAAGRLHC KIDKVNEIVE TNRPDSKNWQ YQETIKKGDL. It is sometimes possible for the material contained within the vial of "PSMD6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.