Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PRKAR1A blocking peptide

PRKAR1A Peptide - C-terminal region

Gene Names
PRKAR1A; CAR; CNC; CNC1; PKR1; TSE1; ADOHR; PPNAD1; PRKAR1; ACRDYS1
Reactivity
Human
Applications
Western Blot
Synonyms
PRKAR1A; PRKAR1A Peptide - C-terminal region; PRKAR1A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
MNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLS
Sequence Length
381
Applicable Applications for PRKAR1A blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PRKAR1A blocking peptide
This is a synthetic peptide designed for use in combination with anti-PRKAR1A Antibody, made

Target Description: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Three alternatively spliced transcript variants encoding the same protein have been observed.
Product Categories/Family for PRKAR1A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
cAMP-dependent protein kinase type I-alpha regulatory subunit isoform a
NCBI Official Synonym Full Names
protein kinase cAMP-dependent type I regulatory subunit alpha
NCBI Official Symbol
PRKAR1A
NCBI Official Synonym Symbols
CAR; CNC; CNC1; PKR1; TSE1; ADOHR; PPNAD1; PRKAR1; ACRDYS1
NCBI Protein Information
cAMP-dependent protein kinase type I-alpha regulatory subunit
UniProt Protein Name
cAMP-dependent protein kinase type I-alpha regulatory subunit
UniProt Gene Name
PRKAR1A
UniProt Synonym Gene Names
PKR1; PRKAR1; TSE1; TSE1
UniProt Entry Name
KAP0_HUMAN

NCBI Description

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Several alternatively spliced transcript variants encoding two different isoforms have been observed. [provided by RefSeq, Jan 2013]

Uniprot Description

PKAR1A: a regulatory subunit of cAMP-regulated protein kinase. The inactive form of the enzyme is composed of two regulatory chains and two catalytic chains. Activation by cAMP produces two active catalytic monomers and a regulatory dimer that binds four cAMP molecules. Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible. Interacts with RFC2: the complex may be involved in cell survival. Defects in PRKAR1A are the cause of Carney complex type 1 (CNC1). CNC is a multiple neoplasia syndrome characterized by spotty skin pigmentation, cardiac and other myxomas, endocrine tumors, and psammomatous melanotic schwannomas.

Protein type: Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 17q24.2

Cellular Component: protein complex; membrane; plasma membrane; cytosol; neuromuscular junction; cAMP-dependent protein kinase complex; AMP-activated protein kinase complex

Molecular Function: protein binding; ubiquitin protein ligase binding; cAMP-dependent protein kinase inhibitor activity; cAMP-dependent protein kinase regulator activity; cAMP binding

Biological Process: epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; water transport; activation of protein kinase A; female meiosis; cardiac muscle cell proliferation; sarcomere organization; signal transduction; regulation of transcription from RNA polymerase II promoter; mesoderm formation; phospholipase C activation; negative regulation of meiosis; energy reserve metabolic process; innate immune response; renal water homeostasis; blood coagulation; regulation of insulin secretion; transmembrane transport

Disease: Myxoma, Intracardiac; Carney Complex, Type 1; Thyroid Carcinoma, Papillary; Acrodysostosis 1 With Or Without Hormone Resistance; Pigmented Nodular Adrenocortical Disease, Primary, 1

Research Articles on PRKAR1A

Similar Products

Product Notes

The PRKAR1A prkar1a (Catalog #AAA3248641) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PRKAR1A Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKAR1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRKAR1A prkar1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNRPRAATVV ARGPLKCVKL DRPRFERVLG PCSDILKRNI QQYNSFVSLS. It is sometimes possible for the material contained within the vial of "PRKAR1A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.