Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

POLR3C blocking peptide

POLR3C Peptide - middle region

Gene Names
POLR3C; RPC3; RPC62
Reactivity
Human
Synonyms
POLR3C; POLR3C Peptide - middle region; POLR3C blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANL
Sequence Length
534
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for POLR3C blocking peptide
This is a synthetic peptide designed for use in combination with anti- POLR3C Antibody, made

Target Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct with other members of the subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. May be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
Product Categories/Family for POLR3C blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
DNA-directed RNA polymerase III subunit RPC3 isoform 2
NCBI Official Synonym Full Names
RNA polymerase III subunit C
NCBI Official Symbol
POLR3C
NCBI Official Synonym Symbols
RPC3; RPC62
NCBI Protein Information
DNA-directed RNA polymerase III subunit RPC3
UniProt Protein Name
DNA-directed RNA polymerase III subunit RPC3
UniProt Gene Name
POLR3C
UniProt Synonym Gene Names
RNA polymerase III subunit C3; RPC62
UniProt Entry Name
RPC3_HUMAN

Uniprot Description

POLR3C: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct with other members of the subcomplex RNA Pol III binding to the TFIIIB- DNA complex via the interactions between TFIIIB and POLR3F. May be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. Belongs to the eukaryotic RPC3/POLR3C RNA polymerase subunit family.

Protein type: Transferase; Transcription initiation complex; Nucleotide Metabolism - purine; Nucleotide Metabolism - pyrimidine; EC 2.7.7.6

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: nucleoplasm; DNA-directed RNA polymerase III complex; nucleus; cytosol

Molecular Function: DNA binding; DNA-directed RNA polymerase activity

Biological Process: transcription from RNA polymerase III promoter; termination of RNA polymerase III transcription; regulation of transcription from RNA polymerase III promoter; positive regulation of innate immune response; positive regulation of interferon type I production; positive regulation of interferon-beta production; innate immune response; gene expression; defense response to virus; RNA elongation from RNA polymerase III promoter

Research Articles on POLR3C

Similar Products

Product Notes

The POLR3C polr3c (Catalog #AAA3247625) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The POLR3C Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPKLSLIGKG KRRRSSDEDA AGEPKAKRPK YTTDNKEPIP DDGIYWQANL. It is sometimes possible for the material contained within the vial of "POLR3C, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.