Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PLGLB2 blocking peptide

PLGLB2 Peptide - middle region

Gene Names
PLGLB2; PRGA; PLGLA; PLGP1; PLGP2; PLGLA1
Reactivity
Human
Applications
Western Blot
Synonyms
PLGLB2; PLGLB2 Peptide - middle region; PLGLB2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENR
Sequence Length
96
Applicable Applications for PLGLB2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PLGLB2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PLGLB2 Antibody, made

Target Description: The function of this protein remains unknown.
Product Categories/Family for PLGLB2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
plasminogen-like protein B
NCBI Official Synonym Full Names
plasminogen like B2
NCBI Official Symbol
PLGLB2
NCBI Official Synonym Symbols
PRGA; PLGLA; PLGP1; PLGP2; PLGLA1
NCBI Protein Information
plasminogen-like protein B
UniProt Protein Name
Plasminogen-like protein B
UniProt Gene Name
PLGLB1
UniProt Synonym Gene Names
PLGL; PRGB

Uniprot Description

PLGLB: May bind noncovalently to lysine binding sites present in the kringle structures of plasminogen. This may interfere with the binding of fibrin or alpha-2-antiplasmin to plasminogen and may result in the localization of activity at sites necessary for extracellular matrix destruction.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2p11.2

Cellular Component: extracellular region

Research Articles on PLGLB2

Similar Products

Product Notes

The PLGLB2 plglb1 (Catalog #AAA3243756) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PLGLB2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLGLB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLGLB2 plglb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSLFSVTKKQ LGAGSREECA AKCEEDKEFT CRAFQYHSKE QQCVIMAENR. It is sometimes possible for the material contained within the vial of "PLGLB2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.