Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PLCB3 blocking peptide

PLCB3 Peptide - middle region

Reactivity
Human
Synonyms
PLCB3; PLCB3 Peptide - middle region; PLCB3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: APGVPLPSPQDLMGRILVKNKKRHRPSAGGPDSAGRKRPLEQSNSALSES
Sequence Length
1167
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PLCB3 blocking peptide
This is a synthetic peptide designed for use in combination with anti- PLCB3 Antibody, made

Target Description: This gene encodes a member of the phosphoinositide phospholipase C beta enzyme family that catalyze the production of the secondary messengers diacylglycerol and inositol 1,4,5-triphosphate from phosphatidylinositol in G-protein-linked receptor-mediated signal transduction. Alternative splicing results in multiple transcript variants.
Product Categories/Family for PLCB3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
128 kDa
NCBI Official Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 isoform 1
NCBI Official Synonym Full Names
phospholipase C beta 3
NCBI Official Symbol
PLCB3
NCBI Protein Information
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
UniProt Protein Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
UniProt Gene Name
PLCB3
UniProt Synonym Gene Names
PLC-beta-3
UniProt Entry Name
PLCB3_HUMAN

NCBI Description

This gene encodes a member of the phosphoinositide phospholipase C beta enzyme family that catalyze the production of the secondary messengers diacylglycerol and inositol 1,4,5-triphosphate from phosphatidylinositol in G-protein-linked receptor-mediated signal transduction. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

PLCB3: a phosphatidylinositol-specific phospholipase C. Binds to calmodulin. The activated enzyme produces the second messenger molecules diacylglycerol and inositol 1,4,5-trisphosphate.

Protein type: EC 3.1.4.11; Carbohydrate Metabolism - inositol phosphate; Phospholipase

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; protein complex; membrane; cytosol

Molecular Function: calmodulin binding; signal transducer activity; calcium ion binding; phosphoinositide phospholipase C activity; phospholipase C activity

Biological Process: synaptic transmission; inositol phosphate metabolic process; regulation of systemic arterial blood pressure; lipid catabolic process

Research Articles on PLCB3

Similar Products

Product Notes

The PLCB3 plcb3 (Catalog #AAA3246560) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PLCB3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: APGVPLPSPQ DLMGRILVKN KKRHRPSAGG PDSAGRKRPL EQSNSALSES. It is sometimes possible for the material contained within the vial of "PLCB3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.