PLA2G2E blocking peptide
PLA2G2E Peptide - middle region
Gene Names
PLA2G2E; sPLA2-IIE; GIIE sPLA2
Reactivity
Human
Applications
Western Blot
Synonyms
PLA2G2E; PLA2G2E Peptide - middle region; PLA2G2E blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP
Sequence Length
142
Applicable Applications for PLA2G2E blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PLA2G2E blocking peptide
This is a synthetic peptide designed for use in combination with anti-PLA2G2E Antibody, made
Target Description: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.PLA2G2E has a preference for arachidonic-containing phospholipids.
Target Description: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.PLA2G2E has a preference for arachidonic-containing phospholipids.
Product Categories/Family for PLA2G2E blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
group IIE secretory phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2 group IIE
NCBI Official Symbol
PLA2G2E
NCBI Official Synonym Symbols
sPLA2-IIE; GIIE sPLA2
NCBI Protein Information
group IIE secretory phospholipase A2
UniProt Protein Name
Group IIE secretory phospholipase A2
Protein Family
UniProt Gene Name
PLA2G2E
UniProt Synonym Gene Names
GIIE sPLA2; sPLA2-IIE
UniProt Entry Name
PA2GE_HUMAN
Uniprot Description
PLA2G2E: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Has a preference for arachidonic-containing phospholipids. Belongs to the phospholipase A2 family.
Protein type: Phospholipase; Secreted, signal peptide; Lipid Metabolism - linoleic acid; Lipid Metabolism - glycerophospholipid; EC 3.1.1.4; Lipid Metabolism - arachidonic acid; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - ether lipid; Secreted
Chromosomal Location of Human Ortholog: 1p36.13
Cellular Component: extracellular region
Molecular Function: phospholipase A2 activity; calcium ion binding
Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; inflammatory response; lipid catabolic process
Research Articles on PLA2G2E
Similar Products
Product Notes
The PLA2G2E pla2g2e (Catalog #AAA3233377) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PLA2G2E Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2G2E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLA2G2E pla2g2e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GIFCAGRTTC QRLTCECDKR AALCFRRNLG TYNRKYAHYP NKLCTGPTPP. It is sometimes possible for the material contained within the vial of "PLA2G2E, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
