PHF5A blocking peptide

PHF5A Peptide - middle region

Cat. Num. AAA3233677

• Gene Names: PHF5A; INI; Rds3; SF3B7; SAP14b; SF3b14b; bK223H9.2
• Reactivity: Human
• Applications: Western Blot
• Synonyms: PHF5A; PHF5A Peptide - middle region; PHF5A blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK
• Sequence Length: 110

• Applicable Applications for PHF5A blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for PHF5A blocking peptide

This is a synthetic peptide designed for use in combination with anti-PHF5A Antibody, made

Target Description: This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes.

Product Categories/Family for PHF5A blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 14249398
• NCBI GeneID: 84844
• NCBI Accession #: NP_116147
• NCBI GenBank Nucleotide #: NM_032758
• UniProt Accession #: Q7RTV0
• Molecular Weight: 12kDa
• NCBI Official Full Name: PHD finger-like domain-containing protein 5A
• NCBI Official Synonym Full Names: PHD finger protein 5A
• NCBI Official Symbol: PHF5A
• NCBI Official Synonym Symbols: INI; Rds3; SF3B7; SAP14b; SF3b14b; bK223H9.2
• NCBI Protein Information: PHD finger-like domain-containing protein 5A
• UniProt Protein Name: PHD finger-like domain-containing protein 5A
• UniProt Gene Name: PHF5A
• UniProt Synonym Gene Names: PHD finger-like domain protein 5A; SF3b14b
• UniProt Entry Name: PHF5A_HUMAN

NCBI Description

This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. [provided by RefSeq, Jul 2008]

Uniprot Description

PHF5A: Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER- alpha. Also involved in pre-mRNA splicing. Belongs to the PHF5 family.

Protein type: RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: nucleoplasm; nuclear matrix; nuclear speck; snRNP U2; U12-dependent spliceosome

Molecular Function: DNA binding; transcription factor activity

Biological Process: nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; RNA splicing; positive regulation of transcription, DNA-dependent; gene expression