Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PDYN blocking peptide

PDYN Peptide - middle region

Gene Names
PDYN; ADCA; PENKB; SCA23
Reactivity
Human
Applications
Western Blot
Synonyms
PDYN; PDYN Peptide - middle region; PDYN blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE
Sequence Length
254
Applicable Applications for PDYN blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PDYN blocking peptide
This is a synthetic peptide designed for use in combination with anti-PDYN Antibody, made

Target Description: The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for PDYN blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
proenkephalin-B preproprotein
NCBI Official Synonym Full Names
prodynorphin
NCBI Official Symbol
PDYN
NCBI Official Synonym Symbols
ADCA; PENKB; SCA23
NCBI Protein Information
proenkephalin-B
UniProt Protein Name
Proenkephalin-B
Protein Family
UniProt Gene Name
PDYN
UniProt Synonym Gene Names
Big Dyn; Dyn-A17; Dynorphin A; Dyn-B
UniProt Entry Name
PDYN_HUMAN

NCBI Description

The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

PDYN: Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. Defects in PDYN are the cause of spinocerebellar ataxia type 23 (SCA23). Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA23 is an adult-onset autosomal dominant form characterized by slowly progressive gait and limb ataxia, with variable additional features, including peripheral neuropathy and dysarthria. Belongs to the opioid neuropeptide precursor family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: plasma membrane; extracellular region

Molecular Function: opioid peptide activity

Biological Process: synaptic transmission; neuropeptide signaling pathway

Disease: Spinocerebellar Ataxia 23

Research Articles on PDYN

Similar Products

Product Notes

The PDYN pdyn (Catalog #AAA3238428) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PDYN Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDYN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDYN pdyn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SELMRDAQLN DGAMETGTLY LAEEDPKEQV KRYGGFLRKY PKRSSEVAGE. It is sometimes possible for the material contained within the vial of "PDYN, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.