Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PDE6C blocking peptide

PDE6C Peptide - C-terminal region

Gene Names
PDE6C; COD4; ACHM5; PDEA2
Reactivity
Human
Applications
Western Blot
Synonyms
PDE6C; PDE6C Peptide - C-terminal region; PDE6C blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEKAAEDSGGGDDKKSKT
Sequence Length
858
Applicable Applications for PDE6C blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PDE6C blocking peptide
This is a synthetic peptide designed for use in combination with anti-PDE6C Antibody, made

Target Description: This gene encodes the alpha-prime subunit of cone phosphodiesterase, which is composed of a homodimer of two alpha-prime subunits and 3 smaller proteins of 11, 13, and 15 kDa. Mutations in this gene are associated with cone dystrophy type 4 (COD4).
Product Categories/Family for PDE6C blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
99kDa
NCBI Official Full Name
cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha'
NCBI Official Synonym Full Names
phosphodiesterase 6C
NCBI Official Symbol
PDE6C
NCBI Official Synonym Symbols
COD4; ACHM5; PDEA2
NCBI Protein Information
cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha'
UniProt Protein Name
Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha'
UniProt Gene Name
PDE6C
UniProt Synonym Gene Names
PDEA2
UniProt Entry Name
PDE6C_HUMAN

NCBI Description

This gene encodes the alpha-prime subunit of cone phosphodiesterase, which is composed of a homodimer of two alpha-prime subunits and 3 smaller proteins of 11, 13, and 15 kDa. Mutations in this gene are associated with cone dystrophy type 4 (COD4). [provided by RefSeq, Mar 2010]

Uniprot Description

Catalytic activity: Guanosine 3',5'-cyclic phosphate + H2O = guanosine 5'-phosphate.

Cofactor: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions

By similarity.

Subunit structure: Composed of two alpha' subunits that are associated with 3 smaller proteins of 11, 13, and 15 kDa.

Subcellular location: Cell membrane; Lipid-anchor; Cytoplasmic side

Potential.

Involvement in disease: Cone dystrophy 4 (COD4) [MIM:613093]: An early-onset cone dystrophy. Cone dystrophies are retinal dystrophies characterized by progressive degeneration of the cone photoreceptors with preservation of rod function, as indicated by electroretinogram. However, some rod involvement may be present in some cone dystrophies, particularly at late stage. Affected individuals suffer from photophobia, loss of visual acuity, color vision and central visual field. Another sign is the absence of macular lesions for many years. Cone dystrophies are distinguished from the cone-rod dystrophies in which some loss of peripheral vision also occurs.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.7

Sequence similarities: Belongs to the cyclic nucleotide phosphodiesterase family.Contains 2 GAF domains.

Research Articles on PDE6C

Similar Products

Product Notes

The PDE6C pde6c (Catalog #AAA3241387) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PDE6C Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDE6C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDE6C pde6c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LQNNRVEWKS LADEYDAKMK VIEEEAKKQE GGAEKAAEDS GGGDDKKSKT. It is sometimes possible for the material contained within the vial of "PDE6C, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.