Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

OPN1MW blocking peptide

OPN1MW Peptide - C-terminal region

Gene Names
OPN1LW; CBP; RCP; ROP; CBBM; COD5
Reactivity
Human
Applications
Western Blot
Synonyms
OPN1MW; OPN1MW Peptide - C-terminal region; OPN1MW blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSSVS
Sequence Length
364
Applicable Applications for OPN1MW blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for OPN1MW blocking peptide
This is a synthetic peptide designed for use in combination with anti-OPN1MW Antibody, made

Target Description: This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called green cone photopigment or medium-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. The long-wavelength opsin gene and multiple copies of the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of deutanopic colorblindness.
Product Categories/Family for OPN1MW blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
red pigment protein
NCBI Official Synonym Full Names
opsin 1, long wave sensitive
NCBI Official Symbol
OPN1LW
NCBI Official Synonym Symbols
CBP; RCP; ROP; CBBM; COD5
NCBI Protein Information
long-wave-sensitive opsin 1
UniProt Protein Name
Long-wave-sensitive opsin 1
UniProt Gene Name
OPN1LW
UniProt Synonym Gene Names
RCP; ROP
UniProt Entry Name
OPSR_HUMAN

NCBI Description

This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called red cone photopigment or long-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. This gene and the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of partial, protanopic colorblindness. [provided by RefSeq, Jul 2008]

Uniprot Description

OPN1LW: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. Defects in OPN1LW are the cause of partial colorblindness protan series (CBP); also known as protanopia. Defects in OPN1LW are a cause of blue cone monochromacy (BCM). A rare X-linked congenital stationary cone dysfunction syndrome characterized by the absence of functional long wavelength-sensitive and medium wavelength-sensitive cones in the retina. Color discrimination is severely impaired from birth, and vision is derived from the remaining preserved blue (S) cones and rod photoreceptors. BCM typically presents with reduced visual acuity, pendular nystagmus, and photophobia. Patients often have myopia. Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

Protein type: Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: integral to plasma membrane

Molecular Function: G-protein coupled receptor activity; photoreceptor activity

Biological Process: positive regulation of cytokinesis; G-protein coupled receptor protein signaling pathway; phototransduction, visible light; visual perception; retinoid metabolic process; signal transduction; protein-chromophore linkage

Disease: Blue Cone Monochromacy; Colorblindness, Partial, Protan Series

Research Articles on OPN1MW

Similar Products

Product Notes

The OPN1MW opn1lw (Catalog #AAA3239432) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The OPN1MW Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OPN1MW can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OPN1MW opn1lw for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SATIYNPVIY VFMNRQFRNC ILQLFGKKVD DGSELSSASK TEVSSVSSVS. It is sometimes possible for the material contained within the vial of "OPN1MW, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.