Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NUP155 blocking peptide

NUP155 Peptide - N-terminal region

Gene Names
NUP155; N155; ATFB15
Reactivity
Human
Applications
Western Blot
Synonyms
NUP155; NUP155 Peptide - N-terminal region; NUP155 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
CCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEF
Sequence Length
205
Applicable Applications for NUP155 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NUP155 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NUP155 Antibody, made

Target Description: Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]).
Product Categories/Family for NUP155 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
nuclear pore complex protein Nup155 isoform 2
NCBI Official Synonym Full Names
nucleoporin 155
NCBI Official Symbol
NUP155
NCBI Official Synonym Symbols
N155; ATFB15
NCBI Protein Information
nuclear pore complex protein Nup155
UniProt Protein Name
Nuclear pore complex protein Nup155
UniProt Gene Name
NUP155
UniProt Synonym Gene Names
KIAA0791
UniProt Entry Name
NU155_HUMAN

NCBI Description

Nucleoporins are proteins that play an important role in the assembly and functioning of the nuclear pore complex (NPC) which regulates the movement of macromolecules across the nuclear envelope (NE). The protein encoded by this gene plays a role in the fusion of NE vesicles and formation of the double membrane NE. The protein may also be involved in cardiac physiology and may be associated with the pathogenesis of atrial fibrillation. Alternative splicing results in multiple transcript variants of this gene. A pseudogene associated with this gene is located on chromosome 6. [provided by RefSeq, May 2013]

Uniprot Description

NUP155: Essential component of nuclear pore complex. Nucleoporins may be involved both in binding and translocating proteins during nucleocytoplasmic transport. Belongs to the non-repetitive/WGA-negative nucleoporin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleoporin

Chromosomal Location of Human Ortholog: 5p13.1

Cellular Component: nuclear membrane; membrane; nuclear pore; nuclear envelope

Molecular Function: structural constituent of nuclear pore; transporter activity

Biological Process: viral reproduction; cytokine and chemokine mediated signaling pathway; mitotic nuclear envelope disassembly; pathogenesis; glucose transport; viral infectious cycle; nuclear membrane organization and biogenesis; mRNA export from nucleus; protein import into nucleus; hexose transport; carbohydrate metabolic process; viral transcription; gene expression; mitotic cell cycle; transmembrane transport

Disease: Atrial Fibrillation, Familial, 15

Research Articles on NUP155

Similar Products

Product Notes

The NUP155 nup155 (Catalog #AAA3236358) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NUP155 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUP155 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUP155 nup155 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CCVMRYTTAG QLWNIISPRE FVDFSYTVGY KEGLLSCGIS LDWDEKRPEF. It is sometimes possible for the material contained within the vial of "NUP155, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.