NSUN5 blocking peptide
NSUN5 Peptide - C-terminal region
Gene Names
NSUN5; NOL1; p120; NOL1R; NSUN5A; WBSCR20; WBSCR20A; p120(NOL1)
Reactivity
Human
Applications
Western Blot
Synonyms
NSUN5; NSUN5 Peptide - C-terminal region; NSUN5 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
ASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRA
Sequence Length
466
Applicable Applications for NSUN5 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NSUN5 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NSUN5 Antibody, made
Target Description: This gene encodes a member of the evolutionarily conserved NOL1/NOP2/Sun domain family. The encoded protein may function as a DNA methyltransferase in the nucleus. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Target Description: This gene encodes a member of the evolutionarily conserved NOL1/NOP2/Sun domain family. The encoded protein may function as a DNA methyltransferase in the nucleus. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Product Categories/Family for NSUN5 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
probable 28S rRNA (cytosine-C(5))-methyltransferase isoform 1
NCBI Official Synonym Full Names
NOP2/Sun RNA methyltransferase family member 5
NCBI Official Symbol
NSUN5
NCBI Official Synonym Symbols
NOL1; p120; NOL1R; NSUN5A; WBSCR20; WBSCR20A; p120(NOL1)
NCBI Protein Information
probable 28S rRNA (cytosine-C(5))-methyltransferase
UniProt Protein Name
Probable 28S rRNA (cytosine-C(5))-methyltransferase
UniProt Gene Name
NSUN5
UniProt Synonym Gene Names
NSUN5A; WBSCR20; WBSCR20A; NOL1R
NCBI Description
This gene encodes a member of an evolutionarily conserved family of proteins that may function as methyltransferases. This gene is located in a larger region of chromosome 7 that is deleted in Williams-Beuren syndrome, a multisystem developmental disorder. There are two pseudogenes for this gene located in the same region of chromosome 7. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Uniprot Description
S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the C5 position of cytosine 3782 in 28S rRNA.
Research Articles on NSUN5
Similar Products
Product Notes
The NSUN5 nsun5 (Catalog #AAA3242479) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NSUN5 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NSUN5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NSUN5 nsun5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASPETTLSSG FFVAVIERVE VPSSASQAKA SAPERTPSPA PKRKKRQQRA. It is sometimes possible for the material contained within the vial of "NSUN5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
