Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NR1D2 blocking peptide

NR1D2 Peptide - N-terminal region

Gene Names
NR1D2; RVR; BD73; EAR-1R; REVERBB; REVERBbeta
Reactivity
Human
Synonyms
NR1D2; NR1D2 Peptide - N-terminal region; NR1D2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGD
Sequence Length
579
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NR1D2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NR1D2 Antibody, made

Target Description: This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described.
Product Categories/Family for NR1D2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
nuclear receptor subfamily 1 group D member 2 isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 1 group D member 2
NCBI Official Symbol
NR1D2
NCBI Official Synonym Symbols
RVR; BD73; EAR-1R; REVERBB; REVERBbeta
NCBI Protein Information
nuclear receptor subfamily 1 group D member 2
UniProt Protein Name
Nuclear receptor subfamily 1 group D member 2
UniProt Gene Name
NR1D2
UniProt Synonym Gene Names
RVR; EAR-1R
UniProt Entry Name
NR1D2_HUMAN

NCBI Description

This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]

Uniprot Description

NR1D2: Binds to the sequences 5'-AATGTAGGTCA-3' and 5'- ATAACTAGGTCA-3'. Acts as a potent competitive repressor of ROR alpha function. Belongs to the nuclear hormone receptor family. NR1 subfamily.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 3p24.2

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor activity; zinc ion binding; steroid hormone receptor activity

Biological Process: transcription initiation from RNA polymerase II promoter; intracellular receptor-mediated signaling pathway; regulation of lipid metabolic process; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; regulation of inflammatory response; rhythmic process; lipid homeostasis; gene expression; steroid hormone mediated signaling; negative regulation of transcription, DNA-dependent; regulation of circadian rhythm

Research Articles on NR1D2

Similar Products

Product Notes

The NR1D2 nr1d2 (Catalog #AAA3244653) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NR1D2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AYISSSSSAS SPASCHSEGS ENSFQSSSSS VPSSPNSSNS DTNGNPKNGD. It is sometimes possible for the material contained within the vial of "NR1D2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.