Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NDUFAF1 blocking peptide

NDUFAF1 Peptide - middle region

Gene Names
NDUFAF1; CGI65; CIA30; CGI-65; MC1DN11
Reactivity
Human
Synonyms
NDUFAF1; NDUFAF1 Peptide - middle region; NDUFAF1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALDITSSE
Sequence Length
35
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NDUFAF1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- NDUFAF1 Antibody, made

Target Description: This gene encodes a complex I assembly factor protein. Complex I (NADH-ubiquinone oxidoreductase) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. The encoded protein is required for assembly of complex I, and mutations in this gene are a cause of mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 19.
Product Categories/Family for NDUFAF1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
327 kDa
NCBI Official Full Name
complex I intermediate-associated protein 30, mitochondrial
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase complex assembly factor 1
NCBI Official Symbol
NDUFAF1
NCBI Official Synonym Symbols
CGI65; CIA30; CGI-65; MC1DN11
NCBI Protein Information
complex I intermediate-associated protein 30, mitochondrial
UniProt Protein Name
Complex I intermediate-associated protein 30, mitochondrial
UniProt Gene Name
NDUFAF1
UniProt Synonym Gene Names
CIA30
UniProt Entry Name
CIA30_HUMAN

NCBI Description

This gene encodes a complex I assembly factor protein. Complex I (NADH-ubiquinone oxidoreductase) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. The encoded protein is required for assembly of complex I, and mutations in this gene are a cause of mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 19. [provided by RefSeq, Dec 2011]

Uniprot Description

NDUFAF1: Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Belongs to the CIA30 family.

Chromosomal Location of Human Ortholog: 15q11.2-q21.3

Cellular Component: cytoplasm; mitochondrial respiratory chain complex I

Molecular Function: protein binding; unfolded protein binding

Biological Process: mitochondrial electron transport, NADH to ubiquinone; protein complex assembly

Disease: Mitochondrial Complex I Deficiency

Research Articles on NDUFAF1

Similar Products

Product Notes

The NDUFAF1 ndufaf1 (Catalog #AAA3246658) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NDUFAF1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFLGIRFAEY SSSLQKPVAS PGKASSQRKT EGDLQGDHQK EVALDITSSE. It is sometimes possible for the material contained within the vial of "NDUFAF1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.